KEGG   Phascolarctos cinereus (koala): 110221734
Entry
110221734         CDS       T05867                                 

Gene name
APAF1
Definition
(RefSeq) LOW QUALITY PROTEIN: apoptotic protease-activating factor 1
  KO
K02084  apoptotic protease-activating factor
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01524  Platinum drug resistance
pcw04115  p53 signaling pathway
pcw04210  Apoptosis
pcw04215  Apoptosis - multiple species
pcw05010  Alzheimer disease
pcw05012  Parkinson disease
pcw05014  Amyotrophic lateral sclerosis
pcw05016  Huntington disease
pcw05020  Prion disease
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05134  Legionellosis
pcw05152  Tuberculosis
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05162  Measles
pcw05164  Influenza A
pcw05168  Herpes simplex virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110221734 (APAF1)
   04215 Apoptosis - multiple species
    110221734 (APAF1)
   04115 p53 signaling pathway
    110221734 (APAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110221734 (APAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110221734 (APAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110221734 (APAF1)
   05012 Parkinson disease
    110221734 (APAF1)
   05014 Amyotrophic lateral sclerosis
    110221734 (APAF1)
   05016 Huntington disease
    110221734 (APAF1)
   05020 Prion disease
    110221734 (APAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    110221734 (APAF1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    110221734 (APAF1)
   05152 Tuberculosis
    110221734 (APAF1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110221734 (APAF1)
   05160 Hepatitis C
    110221734 (APAF1)
   05164 Influenza A
    110221734 (APAF1)
   05162 Measles
    110221734 (APAF1)
   05168 Herpes simplex virus 1 infection
    110221734 (APAF1)
   05169 Epstein-Barr virus infection
    110221734 (APAF1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110221734 (APAF1)
SSDB
Motif
Pfam: WD40 NB-ARC APAF1_C ANAPC4_WD40 CARD Ge1_WD40 Nup160 WD40_like CARD_2 eIF2A AAA_16 AAA_22 ATPase_2
Other DBs
NCBI-GeneID: 110221734
NCBI-ProteinID: XP_020862084
UniProt: A0A6P5M0R2
LinkDB
Position
Unknown
AA seq 1257 aa
MDAKARNCLLQHKEALQRDIKTSYLMDHMISDRVLSLSEEEKIRNQPTQRKRASMLIRVL
LEKDNNSYISFYNALLHEGYKDLAFLLQDGIPLPSYNGKDSVDGVTSYVKTVLCEGGVPQ
RPVVFVTRKKLVKSIQEKLYKLNSEPGWVTVYGMAGCGKSVLAAEAVRDHSLLETCFPGG
VHWVSIGKQDKSGLLMKLQNLCTRLDQDGAFSQRLPLNLEEAKDRLRFLMLRKYPRSLLI
LDDIWDSWVLKAFDSHHQILLTSRDKSVTDSVMGPKYVVSVESGLRKEKGLEILALFVNM
KKTDLPEQAHSIVRECKGSPLVVSLIGALLRDFPNRWDYYLRQLQNKQFKRIRKSSSYDY
EALDEAMSISVERLNEDLQRYYKDLSILQKDVRVPTKVLCILWDMETEEAEDILQEFINK
SLLFYDRNGKSFRYYLHDLQVDFLVEKNRDQLQELHRKVVTQFQRYCKVHCLASDQEDSM
YWYSFLAYHMASADMRQELCDLLFSLDWIKAKTELVGPAHLICEFMRYGRLLDKKGCTVC
ENFQEFLSLNGHLLGRQPFPSIVQLGLCEPETSEVYRQAKRQAKQEVDKGRLYLEWINKK
TIKKLSRLVVRPHTDAVYHACFSEDGLRIASCGADKTLQVLKAETGERLLEVEAHEDEVL
CCAFSKDDRFIATCSVDKKVKIWNARTGELVHTYDEHTEQVNCCHFTNREQHLLLATGSS
DCFLKLWDLNKKECRNTLFGHANSVNHCRFSPNDKYLASCSADGTLKLWDVSSANEWSTI
DVRQHFLSSDGLQEDADLMVKCCSWSSDGARVMAAAVNRLLVRMDVXCFXRHSRNLVGDI
HTGHSSTIRYCDFFPKSHLAVVALSHYCVELWNTDTGLKVADCQGHLSWVHCVAFSPDGS
SFLTSSDDQTIRLWETRKVCKNSAVMLKQEVDVVFREDEVMVLAIDNIQRLQLINGKTGH
TDYLTEAQKSRITCCCLGPGLRYVALGEEEGSVKILELPNGREFLSRMGHEKAVRRVQFT
SDGRTLISSSDDSTVQVWNWQSEEFVFLKAHQEPVKDFRLLQSSRLLTWSFDGTVKVWNI
FTGKVEKDFICHQGTVLSCDVSPDATRFSSTSADKTAKIWSFQSPSPLHELRGHEGCVRC
SVFSGDSTLLATGDDNGEIRIWNVSTGERLHSCVPVTVEKGEATYVGWVTDLRFSPDSRM
LVSAGGYLKWWNVDTGESLQTFYTNGTNLKTIHVSPRFKTYVTVDNLGILYVLQALE
NT seq 3774 nt   +upstreamnt  +downstreamnt
atggatgccaaagctcgcaactgtttgcttcagcacaaggaagccctgcaaagagacatc
aagacttcctacctcatggatcacatgatttctgaccgggttcttagtttgtcagaggag
gagaaaataagaaatcagcctacccaaaggaagagagcatctatgctcattagggtatta
cttgaaaaagataataattcatacatatctttctacaatgctctgctacatgaaggctac
aaggatttggctttccttctccaagatggtattcctcttccttcatataatggaaaggat
tcagtggatggagtgacttcatatgtgaagacagtgctgtgtgaaggtggtgtaccacag
aggcctgttgtgtttgtgaccaggaagaagctggtgaagtcgatccaagaaaagctttat
aaactcaacagcgaacctggatgggtcacagtctatgggatggcaggctgtgggaagtct
gtcctagctgcagaagctgtccgggaccacagcctcttagaaacttgcttcccaggaggt
gtgcattgggtctccattggcaagcaggacaaatctgggctcctgatgaaactccagaat
ctgtgcacccggctggaccaggatggggctttctcccagagactcccgctgaaccttgag
gaagccaaagaccgcctccgtttcttgatgctgcgcaagtatccgaggtctcttttgatc
ttggacgacatttgggattcgtgggtactaaaagcttttgacagtcaccatcagatcctt
ctcactagccgagataagagcgtgaccgactcagtgatgggtcccaaatacgtcgtctca
gtggagagtggcttaagaaaagagaagggattggagatcttggcgctctttgttaatatg
aagaaaacagatcttcccgagcaagcccatagtattgtgagggaatgtaaaggttcccct
cttgtggtatctttaattggtgccctattacgtgatttccccaatcgctgggactactac
ctcaggcagcttcagaataagcagtttaaaaggattaggaaatcttcatcgtatgactat
gaagccctggatgaagccatgtccataagtgtggaaagactgaatgaagacctccagagg
tattataaggacctttccatcctgcagaaggacgttagagtgcccaccaaggtattatgt
attctttgggacatggagactgaagaggctgaggacatcctacaagaattcattaacaag
tccctcctgttttatgaccgaaatgggaagtcattccgttactatttacacgatcttcag
gtcgacttcctcgtggaaaagaaccgtgaccagctccaggagctgcacagaaaggtggtg
actcagttccagagatattgcaaggtgcactgccttgcttctgaccaagaagactccatg
tactggtacagcttcctggcatatcacatggcgagtgctgacatgcgccaagagctttgt
gacctgctgttttccctagactggattaaagcaaagaccgagctggtgggacctgctcat
ttgatatgtgaatttatgcgatatggccgtctgttggataagaagggttgtaccgtctgt
gagaattttcaagagtttttatctctcaatggacatcttcttggacgtcagccgtttccc
agtattgtgcagctaggtctctgcgagcccgaaacttctgaagtgtaccggcaagccaaa
cgacaggccaagcaggaggtcgataaagggaggctgtacttggaatggataaacaaaaaa
accatcaagaaactctcccgtttagttgtccgcccccacacagatgctgtttaccatgcc
tgcttttcagaggacgggctgcggatcgcttcctgtggtgctgataaaaccttacaggtg
ctgaaagcagaaacgggagagaggctgctggaagttgaagcccatgaggatgaagtgctt
tgctgcgctttctccaaggacgatcgattcattgcgacctgttcagtggataagaaagta
aagatttggaatgcaaggaccggggagctggtacacacctatgatgagcacacggagcag
gtcaactgctgtcactttaccaacagggagcagcaccttctcttagccaccggatccagt
gactgcttcctcaaactctgggatctgaataagaaggaatgtcggaacactctgtttggt
catgctaattctgtgaaccactgccgattctcaccgaacgataaatatctggccagctgc
tcagcggatgggacattgaagctttgggatgtgagttcggccaacgaatggagcaccatt
gatgtccggcagcacttcctgagttctgacgggcttcaggaagacgcggacctgatggtg
aaatgttgctcctggtccagcgatggggcgcgagtgatggcagccgccgtcaacaggctt
ttagtacgtatggacgtgtgatgtttttgacgtcatagcaggaacctggtaggagacatc
cacactggtcacagcagcaccatccggtactgcgatttctttcccaagagtcacctcgct
gtggtagctctgtcccactactgtgtggagttatggaatacagatacaggtttaaaagta
gcggactgccaaggacacctgagttgggttcactgtgtggcgttttctcctgacggatct
tcgtttttgacgtcttctgatgatcagacaatcaggctttgggagacaagaaaagtatgt
aagaattctgctgtcatgttaaagcaggaagtagatgttgtattccgagaggatgaagtg
atggttcttgcaattgacaacatacaacgcctacaactaattaatggaaagacaggtcat
accgattatctgacagaagcccaaaaatctcggattacctgctgttgtctgggtccaggc
ctgcgctatgtggcgttgggagaagaagaggggtccgtaaagattttagagctccccaat
ggaagagagtttctatctcgaatggggcatgagaaagctgtccgacgggtccagttcacc
tctgatgggaggacccttatttcaagttctgatgattccacagttcaggtgtggaattgg
cagtcggaggagtttgtgtttctcaaagcgcaccaagagcccgtgaaggactttcggctc
ctgcagagttcacggctcctgacatggtcatttgatgggacagtgaaggtctggaatatc
ttcactggcaaagtcgagaaggactttatttgccaccaaggtacagttttgtcctgtgat
gtttctcccgatgccaccaggttttcatccacctctgctgacaagactgcaaagatttgg
agctttcagagcccttcccctcttcatgagctgaggggtcacgaaggctgtgtgcgatgc
tctgtcttctctggggacagcaccctcctggcgacgggagacgacaatggagaaatcagg
atatggaacgtctccacgggggagcggcttcattcctgtgttcctgtgactgtggagaaa
ggagaggcgacctacgtgggctgggtgaccgacctccgcttttctcctgatagcagaatg
ctcgtgtcggccgggggctatctgaagtggtggaacgtggacaccggcgaatccttacag
accttctacaccaatggaaccaacctcaagacgatacacgtgtctcctcgtttcaaaaca
tacgtgactgttgataatcttggaattttgtatgtactacaagcactagaatga

DBGET integrated database retrieval system