KEGG   Phascolarctos cinereus (koala): 110223345
Entry
110223345         CDS       T05867                                 

Gene name
JAK3
Definition
(RefSeq) tyrosine-protein kinase JAK3
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04062  Chemokine signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04217  Necroptosis
pcw04550  Signaling pathways regulating pluripotency of stem cells
pcw04630  JAK-STAT signaling pathway
pcw04658  Th1 and Th2 cell differentiation
pcw04659  Th17 cell differentiation
pcw05161  Hepatitis B
pcw05162  Measles
pcw05166  Human T-cell leukemia virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05200  Pathways in cancer
pcw05203  Viral carcinogenesis
pcw05223  Non-small cell lung cancer
pcw05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110223345 (JAK3)
   04151 PI3K-Akt signaling pathway
    110223345 (JAK3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110223345 (JAK3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110223345 (JAK3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    110223345 (JAK3)
   04659 Th17 cell differentiation
    110223345 (JAK3)
   04062 Chemokine signaling pathway
    110223345 (JAK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110223345 (JAK3)
   05203 Viral carcinogenesis
    110223345 (JAK3)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    110223345 (JAK3)
  09163 Immune disease
   05340 Primary immunodeficiency
    110223345 (JAK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110223345 (JAK3)
   05161 Hepatitis B
    110223345 (JAK3)
   05162 Measles
    110223345 (JAK3)
   05169 Epstein-Barr virus infection
    110223345 (JAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110223345 (JAK3)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     110223345 (JAK3)
Protein kinases [BR:pcw01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   110223345 (JAK3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl SH2 APH
Other DBs
NCBI-GeneID: 110223345
NCBI-ProteinID: XP_020864464
UniProt: A0A6P5M1B5
LinkDB
Position
Unknown
AA seq 1103 aa
MAPLGEDTPLIEQRSYSLSSSEAGSLQVLLCPRNPGSPQVLTFSFGEYSAEQLCVQAAKA
CGILPVCHALFALATEDLSCWFPPNHVFMVEDATVQILLYRIRFVFPNWLGLEKCYRFGL
QKDRANAILDFPVLEYLFAQSRSDFITGRMNLTLSLKEQGECLSLAVLDLTRMAQEQGLC
SKEILRSISYKACIPGSFRRLIQSLSFMTRKRYRQMVHRALQRVASCQADVHSIMLKYLM
DLERLKSTRASETFEGRTPGATSGRDSNCLIHVAGDSGISWTPEGSESPQPFCDFPEIVD
IGIKQACREGHLSESRLVTVTKTDNRILEVEFPALREALSFISLVDGYYRLTTDAHHYFC
KEVAPPQLLENIDNQCHGPIMSEFAVNKLKLGGSVPGSYVLRQSPQDFNSFLLTVCIQTS
LGPDYKGCLIHRDVSGNLFLSGLSRAHSSLRQLLESSRGCGLLVDGTALSLSSCCPPRPK
EKSNLIIVRRDCTLTPAQAWPQPQCQLNQMMFHKIPADSLEWHENLGHGSFTKIYRGSRL
DKVDGETHKVEILLKVMDSTHQNCIESFLEAASIMSQVSHQHLVLLHGVCMAGDSIMVQE
FVRWGALDTHLRKCGPLVPASWKLQVAKQLSYALNYLEDKGIIHGNISSKKVLLAREGTG
GSPPFIKLSDPGVSPTVLTKEMLTDRIPWLAPECLWDAKLLSLESDKWSFGATLWEIFSG
GTIPLSALEPTKKLQFYKEKQQLPALKWTELATLIGQCMEYTPHLRPSFRAIIRDLNSLI
TSDYELLSDLSPSAVAARDGLWSSAHLMAGQDPTLFEERHLKYISLLGKGNFGSVELCRY
DPLGDNTGALVAVKQLQNSGPQQLQDFQREVQILKALHSDFIVKYRGVCYGPGRQSLRLV
MEYLPNGCLRDYLQRHRAHLDPCFLLLYASQICKGMEYLGSQRYVHRDLANRNILVESES
HVKIGDFGLAKLLPQDKEYYVVREPGQSPIFWYAPESLSDNIFSRESDVWSFGVVLYELY
TYSDKAHSPSEEFFRMMACDRSMPILCHLLELLTEGRRLPTPPGCPGEVREIMRSCWAYN
PKDRPSFCALGPRLDALWAGRRG
NT seq 3312 nt   +upstreamnt  +downstreamnt
atggcgcctctgggggaggacacccccctgattgaacagcggtcctacagcctctcctcc
agcgaggccggctccctgcaagtgctcctgtgtccccgaaacccagggtccccgcaggtc
ctcaccttctcctttggggagtactctgctgaacagctctgtgtgcaggctgccaaggcc
tgcgggatcttgcctgtatgccatgctctctttgccctggccactgaagacctgtcctgc
tggttcccacccaaccacgtcttcatggtggaagatgctaccgtccaaattctcctttac
aggatccgatttgtcttcccaaactggctcggcctggagaagtgttaccgctttgggcta
cagaaggaccgagccaacgccatcctggacttcccggttctcgagtatctctttgctcag
tcccgaagtgacttcatcactgggaggatgaatctgactctgagccttaaggagcaggga
gagtgcctgagcctggcagtgttggacctgactcggatggcacaggagcagggcctgtgc
tccaaggagattctcaggagcatcagctacaaagcctgtatcccaggaagcttccgacga
ttgattcagagtctcagcttcatgactcggaagcgttatcgtcagatggtgcaccgagcc
ctgcagagagtggcatcctgccaggcagatgtgcactcaatcatgctaaaatacctcatg
gacctggagaggctgaaatccacccgggcttcagagaccttcgagggccggacgccaggg
gctacatctggccgggactccaactgtctcatccacgtggcgggagacagcggcatctcc
tggacccctgagggcagtgagagcccacagcctttctgcgatttccctgaaatcgttgat
atcggcatcaagcaggcctgcagggaaggtcatctcagcgagagccgactggtcactgtt
accaagactgacaacaggatcctggaagttgaatttccagctctaagggaggcgctgtcc
tttatctctctggttgatggctactaccgactcacaactgatgcccaccactacttctgc
aaagaggtggccccaccccagctcttggagaacattgacaaccaatgccatggtcccatc
atgtccgagtttgccgtgaacaagctgaagttgggggggtcagttccgggatcctacgtc
cttcggcaaagcccccaggacttcaacagcttcctcctcactgtctgtatccagacgtcc
ctgggcccagactacaagggctgcttaatccaccgggacgtttcagggaacctcttcttg
tctgggctgagccgggcccacagcagcctgcgacagctgctggagtcctccaggggctgc
gggctccttgtagatgggactgcactgagcctcagtagctgctgtccccccaggcccaaa
gagaagtccaacctgatcatagtgagaagggattgcaccttaaccccagcccaggcctgg
cctcagccccagtgccagctcaaccaaatgatgttccacaaaatccctgctgacagcttg
gagtggcatgagaacctgggccacggctccttcaccaagatctaccgtggtagccgcctg
gataaggtggacggggagacccacaaggtagagatcctgctcaaggtgatggacagcaca
caccagaactgcattgagtccttcctagaggctgccagcatcatgagtcaagtgtcccac
cagcacctggtgctgctgcatggtgtctgcatggcaggagatagtatcatggtacaggag
tttgtgagatggggggcactcgatacccacttacggaagtgcgggcccctggtacctgcc
agttggaagctccaagtggccaagcaactttcttacgctctcaactacctggaagacaaa
ggcatcatccatggcaatatctcctccaagaaggtcctcctagcgagggaaggaactggg
gggagcccccctttcatcaagctcagcgaccctggggtcagtcccactgtgctgaccaaa
gagatgctcactgaccggatcccctggctggctcccgagtgtctgtgggatgccaagctg
ctgagcctggaatctgacaagtggagctttggggcaacactctgggagatattcagtggg
ggcaccattcccctaagtgccctggagcccaccaagaaactccagttctacaaggagaag
cagcagctgccagccctgaaatggacagagctagccaccctgatcggccagtgcatggag
tacactcctcacctgcggccctccttccgagccatcatccgggatctcaatagcctcatc
acctcagattatgagctcctctcagatctctcacctagtgctgtggcggctcgggatgga
ctctggagcagcgctcacctgatggctggccaggaccccaccctctttgaggagagacac
cttaaatatatctccctgctgggcaagggcaactttggcagtgtggaattgtgtcgctat
gacccgctgggagataacacgggagcgctggtggcagtcaagcagctacagaacagtggg
ccccagcagcttcaggacttccagcgagaggtgcagattctgaaagcattacacagtgac
ttcatagtcaaatatcgaggcgtctgctatggcccaggccgacagagtctgcgcctcgtt
atggaatacctccccaacggctgcctccgggactacctgcagcgtcaccgggcccaccta
gacccctgtttcctcctcctctacgcttcccagatctgcaagggaatggaatacctgggc
tctcagcgatatgttcacagagacttagccaacaggaacatcttggtggagagtgagagc
cacgtgaagattggagactttggcctggccaaacttcttccccaggacaaagaatactac
gtagtcagggagcctggccagagccccatcttctggtatgccccagagtccttgtcagac
aacatcttctccagggagtctgatgtctggagttttggcgtggtcctctatgagctttat
acatatagtgacaaagcccacagcccttcagaggagttcttccgaatgatggcatgtgac
cgctccatgcccatcctctgccacctgctggagctgcttacggagggcaggcggttgccc
actcctcctggctgcccaggagaggttcgagagatcatgaggagctgttgggcctacaac
cccaaggaccggccttccttctgtgccctggggccccggcttgatgctttgtgggctggg
cgcagagggtag

DBGET integrated database retrieval system