KEGG   Phascolarctos cinereus (koala): 110223919
Entry
110223919         CDS       T05867                                 

Gene name
DDB2
Definition
(RefSeq) LOW QUALITY PROTEIN: DNA damage-binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw03420  Nucleotide excision repair
pcw04115  p53 signaling pathway
pcw04120  Ubiquitin mediated proteolysis
pcw05161  Hepatitis B
pcw05169  Epstein-Barr virus infection
pcw05200  Pathways in cancer
pcw05202  Transcriptional misregulation in cancer
pcw05210  Colorectal cancer
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05216  Thyroid cancer
pcw05217  Basal cell carcinoma
pcw05218  Melanoma
pcw05220  Chronic myeloid leukemia
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110223919 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    110223919 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    110223919 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110223919 (DDB2)
   05202 Transcriptional misregulation in cancer
    110223919 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110223919 (DDB2)
   05212 Pancreatic cancer
    110223919 (DDB2)
   05225 Hepatocellular carcinoma
    110223919 (DDB2)
   05226 Gastric cancer
    110223919 (DDB2)
   05214 Glioma
    110223919 (DDB2)
   05216 Thyroid cancer
    110223919 (DDB2)
   05220 Chronic myeloid leukemia
    110223919 (DDB2)
   05217 Basal cell carcinoma
    110223919 (DDB2)
   05218 Melanoma
    110223919 (DDB2)
   05213 Endometrial cancer
    110223919 (DDB2)
   05224 Breast cancer
    110223919 (DDB2)
   05222 Small cell lung cancer
    110223919 (DDB2)
   05223 Non-small cell lung cancer
    110223919 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110223919 (DDB2)
   05169 Epstein-Barr virus infection
    110223919 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pcw04121]
    110223919 (DDB2)
   03400 DNA repair and recombination proteins [BR:pcw03400]
    110223919 (DDB2)
Ubiquitin system [BR:pcw04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     110223919 (DDB2)
DNA repair and recombination proteins [BR:pcw03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      110223919 (DDB2)
SSDB
Motif
Pfam: WD40 Ge1_WD40
Other DBs
NCBI-GeneID: 110223919
NCBI-ProteinID: XP_020865338
UniProt: A0A6P5M632
LinkDB
Position
Unknown
AA seq 493 aa
MAPKRPAGLGKRSAPALEPPRAKRNCVRIPGRRSRPPTWGVGRGDDASGWNQLGLTGQRE
YPHSIIWALGQHKLGRAPRTSFQQCLQKAFLHSLDSYRLFRTASPFDRRTTCLEWHPTHP
STLAVGSKGGDIILWDYEVLDKTYFIKGIGAGGSITGMKFNPLNTSQLFISSVAGTTSLK
DFLGNTIRVFTSTNTWDYWYTSVDVSARSRVVVTGDSVGNVILLNMDGKEIWNLRLHKKK
VTHVALNPLCDWLLATASVDQTVKIWDLRQVRGKSSFVHWMPHERAVNAAYFSPDGAKLL
TTDQHSEIRVYSASHWACPQHLIPHPHRHFQHLTPIKATWHPRYDLIVVGRYPDPNFAGF
TPHELRTIDLFDGSSGKMMCQLYDPDCSGIISLNKFNPMGDTLASAMGYNILIWSPGEAV
RRKQEGLIKVMSEQGLGRGRSAHQPSPRNRPGQNXSKQQQKGVCLEGYARTQPKGQALGA
HLGQGPFLWKAGG
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggctcccaagcgaccggcgggcctcggcaagaggagcgccccagccctggagcctccc
cgggccaagaggaactgtgtgcggatccccggccgcagaagccggccgccaacctggggc
gtgggtagaggagatgatgcttcaggctggaatcagcttgggttgactggtcagagagaa
taccctcatagcatcatttgggctctcggtcaacataagctgggcagagcgcctcggaca
tccttccagcagtgtcttcagaaggcctttttgcactctttggactcttaccgacttttc
cgcacagctagtccctttgatcggagaacaacgtgcctggagtggcacccgactcacccc
agcactctggctgtgggctccaagggtggagacatcatcctgtgggattatgaagtactg
gacaaaacctacttcattaaagggattggagctggagggagcatcacagggatgaaattt
aaccctcttaataccagccagctgttcatttcctcagtggcggggaccaccagcctgaag
gactttctgggcaatactatcagagtcttcaccagcacaaacacctgggactactggtac
accagtgtggatgtatctgccagaagccgtgtagtggtcacaggagatagtgtgggcaat
gtgatcttgctgaacatggatggcaaagagatctggaatctgaggcttcacaaaaagaag
gtgacccatgtagctctgaatcctctctgtgactggttgctggccacagcctcagtggac
caaacagtgaaaatctgggacctgcgccaggtcagagggaaatcttccttcgtccactgg
atgcctcatgagcgtgccgtcaatgcagcttatttcagtccagatggggccaaactcctg
accacagaccagcatagcgagatccgggtgtactccgcctcccattgggcatgtcctcag
catctcattccccaccctcatcgccacttccagcaccttacgcccatcaaggcaacatgg
caccctcgttacgacctcatcgtggtgggtcgatatccagaccccaattttgcaggtttc
acccctcatgagcttcggacgattgatctatttgatgggagttcggggaagatgatgtgt
cagctttatgatccagactgctctggcatcatctcgcttaacaagtttaatcccatgggg
gacacgttggcctctgcaatgggttacaacattctcatctggagcccaggggaggctgtg
agaaggaagcaggaggggctgatcaaggtgatgagtgaacaaggactagggaggggcagg
tcagcccaccagccctcccctcgaaacagaccaggccagaatnntagcaaacagcagcag
aagggtgtgtgcctagaagggtatgcaagaactcagcccaaagggcaggctttaggagcc
cacctgggccaaggccctttcctctggaaggccgggggatag

DBGET integrated database retrieval system