KEGG   Paenibacillus crassostreae: LPB68_01980Help
Entry
LPB68_01980       CDS       T05196                                 

Definition
(GenBank) dienelactone hydrolase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pcx  Paenibacillus crassostreae
Pathway
pcx00010  Glycolysis / Gluconeogenesis
pcx00020  Citrate cycle (TCA cycle)
pcx00620  Pyruvate metabolism
pcx01100  Metabolic pathways
pcx01110  Biosynthesis of secondary metabolites
pcx01120  Microbial metabolism in diverse environments
pcx01130  Biosynthesis of antibiotics
pcx01200  Carbon metabolism
Module
pcx_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pcx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LPB68_01980
   00020 Citrate cycle (TCA cycle)
    LPB68_01980
   00620 Pyruvate metabolism
    LPB68_01980
Enzymes [BR:pcx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LPB68_01980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 NQRA RnfC_N ATP-synt_ab_Xtn Transferase
Motif
Other DBs
NCBI-ProteinID: AOZ91092
UniProt: A0A167DT58
LinkDB All DBs
Position
complement(419689..421311)
Genome map
AA seq 540 aa AA seqDB search
MAKFEYRFPELGEGLHEGEIIKMHIKVGDKVTDDDIVMEVQNDKAVVEVPCPVNGTVLEV
FTKDGQVCRVGEVVAIIDAEGDVPEQDEPAAEQSVPAPVATQSAPAANSGSVNFEYRFPE
LGEGLHEGEIIKMHIKVGDKVTDDDIVMEVQNDKAVVEVPCPVNGTVLEVLTKDGQVCRV
GDVVAIIAAEGEVPEQEGAHAAQEVDTAKGSANTTATATPVAAPNKDVLATPSVRKFARE
QGVNISNVTGSGTNGKITKKDVESFMSGGQATAAPAASAAPSAAKDAATTTAPAKAASTT
AVASNANLDEERVPFKGIRKAISNAMVKSAYTAPHVTIMDEVDVTDLVDFRTRMKPIAEK
KGIKVTYLPFIVKALVAASRQFPALNAMIDEESNEIVYKKYYNIGIATDTPNGLIVPVIK
DADRKSIWMIAESIADLAIRGRDGKLSANEMKGSTISISNIGSAGGMFFTPIINFPEVAI
LGVGRISDKPVIKNGEIVAAKVMALSLSFDHRIIDGATAQHFMNYIKSLLANPESLVMEV
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaatttgaatatcgattcccagaattaggtgaaggcctacatgaaggtgaaatt
attaaaatgcatatcaaagttggtgataaagtcactgatgatgatatcgtcatggaagtt
cagaatgataaagcagtcgttgaagttccttgtccagtgaatggtacggtacttgaggta
tttaccaaagacggtcaagtatgtcgtgtaggtgaagtggtagctatcattgatgcagaa
ggcgatgtgcctgagcaagatgaaccagcagcagaacaatctgtaccagcaccagtagct
actcaatctgcaccagcagcaaattctggatcggttaattttgaatatcgtttcccagaa
ctaggcgaaggcttgcatgaaggcgaaatcattaaaatgcatatcaaagttggtgacaaa
gtcactgatgatgatatcgtcatggaagtacaaaatgataaagccgttgttgaagttcct
tgtccagtgaacggtacagtacttgaagtacttaccaaagacggtcaagtatgtcgtgta
ggtgatgtagtggctattatagctgctgaaggagaagtgcctgagcaagaaggtgcgcat
gctgcacaagaagtagacacagcaaaaggcagtgcgaatacaactgctacagcaactcca
gtagctgctcccaataaagatgttctagctacacctagtgtgcgtaaatttgctcgtgag
caaggtgtgaatatctctaacgttactgggtcaggtacaaatggtaaaatcacgaaaaaa
gatgttgaatccttcatgagtggtggtcaagcaactgcggcaccagcagcatcggcagcg
ccaagtgcagctaaagatgcggcaactacaactgctccagcaaaagcggcttcaacaact
gcggttgcgagtaatgcgaatcttgatgaagaacgtgtaccattcaaaggaattcgtaaa
gcaatctctaatgcgatggttaaatctgcttacacagcaccacatgttacgattatggat
gaagtagacgtaactgatctagtagatttccgtactcgtatgaaaccaatcgctgagaaa
aaaggaatcaaagtaacttatcttccatttatcgtaaaagcattggttgcggcaagtcgc
caattccctgcacttaacgcgatgattgatgaagaaagtaatgaaattgtatataagaag
tactataatatcgggattgcaacagatacaccaaatggcttgattgttccagttattaaa
gatgctgatcgtaagagtatctggatgattgcggaatctattgctgatcttgcaattcgt
ggacgcgatggtaaattgagcgcgaacgaaatgaaaggtagtaccatttcaatctccaat
attggttctgctggtggtatgttctttacaccaattattaacttccctgaagttgctatc
ttgggtgtaggtcgtatttctgacaaaccagtaattaagaatggtgaaattgttgcagcg
aaagttatggcattgtccctaagctttgaccatcgtattattgatggcgcgactgcacaa
catttcatgaactacattaaatcgcttctcgctaatcccgagtcgctagttatggaggtt
taa

DBGET integrated database retrieval system