KEGG   Paenibacillus crassostreae: LPB68_02320Help
Entry
LPB68_02320       CDS       T05196                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pcx  Paenibacillus crassostreae
Pathway
pcx00010  Glycolysis / Gluconeogenesis
pcx00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:pcx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LPB68_02320
   00500 Starch and sucrose metabolism
    LPB68_02320
Enzymes [BR:pcx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LPB68_02320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AOZ91156
UniProt: A0A167DR51
LinkDB All DBs
Position
493859..495274
Genome map
AA seq 471 aa AA seqDB search
MNLQFPDGFLWGGAVAANQCEGAYNEDGKGWSTQDVAPEGIKGPITEVPTDNNMKLIGID
FYHRYKEDIKLFAEMGFKVFRTSIAWSRIFPNGDELEPNEQGLQFYDDLFDECHKYGIEP
LVTISHYETPLHLSKQYNGWVNRKLIGFYERYARTLFTRYKDKVKYWLTFNEINSILEEP
FMSGGIYTPKQDLSKQDLYQAIHHEFVASALAVKIGHELAPNAQIGCMVLSMPTYPLTPN
PDDVIATMEYEHKNYFFADVHARGIYPGYMKRYFRENNINIHMEPEDAEILRHTVDFISF
SYYVSTCESGASSQLGESEGNLMGRVANPYLKTSEWGWHIDPQGIRYVMNMFYDRYQKPL
FVVENGLGAIDKLITNDQGEKTVEDDYRIDYLNDHLVQVAEAIADGVEVIGYTSWGCIDL
VSASTAQLKKRYGFIYVDRHDDGSGTLERYRKKSFHWYKDIISSNGQTLQR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaatctacaatttccagatggtttcttatggggcggagccgtagctgctaaccaatgt
gaaggagcttataatgaggatggcaaaggttggtccactcaggacgtggcaccagaagga
attaaaggccctattactgaggtgcctactgataacaatatgaaactgattggtattgat
ttttaccatcgctataaagaagatattaagttatttgcagaaatgggattcaaagtattc
agaacttccattgcttggtctcggatttttccgaacggtgatgaattagaacctaatgaa
caaggcctacaattttacgacgacctgtttgatgaatgccacaaatatgggatcgagcct
ctcgttacgatctctcattatgagacaccgctgcatttgtccaagcaatataatggctgg
gtcaaccgtaagttaattggattttatgagcgttacgcaagaacactatttacccgctat
aaggacaaagtgaaatattggttgaccttcaatgagatcaattcgattctcgaagaaccg
tttatgagtggcggtatttacacacctaagcaggatttaagcaaacaagacctatatcag
gccatccatcatgaatttgtagccagtgcgttagctgtcaaaatcggtcatgaacttgca
ccaaatgcacagattggttgtatggtgctcagtatgccgacttacccattgactccaaat
cccgatgatgtgatcgcaactatggaatatgagcacaaaaactatttctttgccgacgtt
cacgccagagggatctatcctggttatatgaaacgctatttcagagagaataacattaac
attcatatggaaccagaagatgcagaaattctacggcacaccgtggactttatttcattc
agctattatgtgagcacttgtgaatcgggtgcatcgtcccagctgggagaaagcgaaggc
aacttgatgggtagagtggctaacccgtatttgaaaacgagtgaatggggttggcatata
gatcctcagggtatacgttatgtcatgaatatgttctatgatcgctatcagaagccactg
tttgttgtagagaatggcttaggcgccatcgacaaattgatcaccaatgatcaaggtgaa
aagacagttgaagatgactaccgaattgattacttgaatgatcatctggtacaagtagcc
gaggcaattgcagacggcgtcgaagtcataggttacacatcgtggggatgtattgacctt
gtcagtgcttctaccgctcaattaaagaaacgttatggattcatttatgtagaccgtcat
gacgatggctcgggcacacttgaacgataccgtaagaagtcattccattggtataaggac
atcatcagttccaacgggcaaactttgcagcgttaa

DBGET integrated database retrieval system