KEGG   Paenibacillus crassostreae: LPB68_19445Help
Entry
LPB68_19445       CDS       T05196                                 

Definition
(GenBank) MarR family transcriptional regulator
  KO
K15973  MarR family transcriptional regulator, 2-MHQ and catechol-resistance regulon repressor
Organism
pcx  Paenibacillus crassostreae
Brite
KEGG Orthology (KO) [BR:pcx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcx03000]
    LPB68_19445
Transcription factors [BR:pcx03000]
 Prokaryotic Type
  Helix-turn-helix
   MarR family
    LPB68_19445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 HTH_34 TrmB HTH_24
Motif
Other DBs
NCBI-ProteinID: AOZ94805
UniProt: A0A167G520
LinkDB All DBs
Position
4202200..4202655
Genome map
AA seq 151 aa AA seqDB search
MNKTKDNNDLSLDLFIVLVRAYNSVVAHSTRSIQSHGLNSTEFGVLDLLFHKGPQPLQKI
GEKVLISSGNITYVADKLQSKNLLVRIASPDDRRVIFADLTEEGRTFMEEVFPQHENVIA
HSVEGLNEDEKKLAISLLKKLGHSAESASRL
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
attaataagacaaaagataacaatgatctttcattagatttattcattgtattggtgcga
gcctataattccgtggtagctcattccactcgtagcatccaaagtcatggattgaattca
acagagtttggagtactggacttgttgtttcataaggggccacaaccgttgcagaaaatt
ggtgagaaagtacttatctcaagtgggaatattacttacgttgctgataaacttcaaagt
aagaacttattggttcgaattgcttctcctgatgatcgtcgtgtgatttttgctgatcta
acggaagaaggaagaacctttatggaagaagtatttcctcaacatgagaacgttattgct
cattctgtagaaggtctaaatgaagatgaaaagaaactagctatcagcttactaaagaag
ttaggacattcagccgagagtgcaagtagactttaa

DBGET integrated database retrieval system