KEGG   Plasmodium cynomolgi: PCYB_121780Help
Entry
PCYB_121780       CDS       T02490                                 

Definition
(RefSeq) hypothetical protein
Organism
pcy  Plasmodium cynomolgi
SSDB OrthologParalogGFIT
Motif
Pfam: Spindle_Spc25 Spc7 Exonuc_VII_L DUF745 MCPsignal Reo_sigmaC MAD Effector_1 Atg14 DUF16 DUF4863 LEF-9 Band_3_cyto TMPIT P4Ha_N Sec8_exocyst ALMT Mnd1
Motif
Other DBs
NCBI-GeneID: 14693979
NCBI-ProteinID: XP_004223557
UniProt: K6UYG2
LinkDB All DBs
Position
12
AA seq 216 aa AA seqDB search
MEDVINNNEVKRAMQQQLNEMVEENEKQYNDLISYIENEKKQIEIMKNKTREKKSSINRI
THEIEANTVLVTELKESVMEEEKKLDEYPKLIEEINEQLNLILKNFDSSKLEYNTVKLHK
DYIQNEWKRKLGTLYNLLGFEIILQDDKIVIEFSNIQPGDPQKKYRATVALHNGTYEAIE
TAPRLNKFDDYVNGLNKGLPFTTFCCLLRKSFKELK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgtgattaacaacaacgaggtaaagcgggccatgcagcaacagctgaatgag
atggtcgaagaaaacgaaaagcagtacaacgacttaatatcttacatagaaaatgagaaa
aagcaaattgaaatcatgaaaaacaaaacgagggagaagaaaagttcaataaacaggata
acccacgaaatcgaagccaataccgtcctagtcacagagctgaaggagagcgtgatggaa
gaggagaaaaagctggacgaataccccaagctgattgaagaaattaacgaacaactgaat
ttaattttaaaaaatttcgactcctccaagttggagtacaacacggtcaagctgcacaag
gactacattcaaaatgagtggaaaagaaaattgggcactctctacaatctgctgggattt
gaaatcatattacaagatgacaaaatagtaatcgaattttcgaatattcaacccggggat
cctcagaagaaatatcgagccaccgtcgctttgcacaacgggacctacgaagccatcgaa
accgcgccgcgactgaacaaatttgacgattatgtaaacggcctaaataagggactgccc
ttcacaaccttctgctgcttactcagaaagtcattcaaagaattaaaatag

DBGET integrated database retrieval system