KEGG   Plasmodium cynomolgi: PCYB_134530Help
Entry
PCYB_134530       CDS       T02490                                 

Definition
(RefSeq) POM1
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
K17680  twinkle protein [EC:3.6.4.12]
Organism
pcy  Plasmodium cynomolgi
Pathway
pcy03030  DNA replication
pcy03410  Base excision repair
pcy03420  Nucleotide excision repair
pcy03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pcy00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    PCYB_134530
   03410 Base excision repair
    PCYB_134530
   03420 Nucleotide excision repair
    PCYB_134530
   03440 Homologous recombination
    PCYB_134530
Enzymes [BR:pcy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PCYB_134530
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PCYB_134530
DNA replication proteins [BR:pcy03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     PCYB_134530
DNA repair and recombination proteins [BR:pcy03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     PCYB_134530
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     PCYB_134530
Mitochondrial biogenesis [BR:pcy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Mitochondrial DNA maintenance factors
    PCYB_134530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_A DNA_pol_A_exo1 AAA_25 AAA_22 DnaB_C Toprim_2 ATPase RsgA_GTPase AAA_16
Motif
Other DBs
NCBI-GeneID: 14694957
NCBI-ProteinID: XP_004224526
UniProt: K6UXS6
LinkDB All DBs
Position
13
AA seq 1882 aa AA seqDB search
MPIVAKTRMQQSANLAQGESLHAAYEREYMPLRNKSRPKTDFYLKTNCELVRRRKNGSKV
YFKRKARGEDWGSRACYDPRRGGRYSHSSGGNRRNRSNRDSGALRATSTFVSKYYKININ
DVYSYLNRKKYEYIETDVKITLKYCPFCPPHKYKYDNMYKHEIFKNTGNSYCHRCGYKGS
FYDFKLKMGDLVTSNFENSVVSNTYEEEKISFNDVKVYSMNLLYSKEAEAARKYLIEERK
LNLQTLKKYYVGFSIMEFQSLENSGKFEKHECLIFPFIKKANDLNSMGLNGNKNNTNEKD
SYEIVRIKVRSLRDKGYMRLYPKNVKDEMKLFFFGDHLVSNSEEVVLTEGEIDAMTVSQE
TNYAAISLPNGSKSLPIYLLPYLERFKKIHLWLDFDKAGKSSVFNFVNKIGLGRTNVITD
ANVHYLDEQLFERKRKNLLTKGGLLLPLTVGDNPIGVAEQKQGGIKENTQSDEKNGHTEG
TQDGKGPNTDVDPMSGTNKSDLKIAEKAKNEGDSRNNPSCGDTGNTQGEAQKKEREEEGC
KARTFHFVQNNIMYIPNNIVVKDANDCLKHNIDIRFFIENSEKVKHSQILNFNDLRQNIL
EELKYPDRINGIKSKTIPSLNKFLYGLRMGELSIWTGPTGVGKTTLLSQLSLDYCIQGVS
TLWGSFEINNIKLGKVMLNQFCGKNLEKNIDLFDLYADKFELLPLKFLKFHGSTNIDQVL
DAMDYAVYAYDVKHIIIDNLQFMLNINKFSDIYELQNIAIDKFRSFSTNKNVHITLVVHP
RKEDNNLLSIASVFGSVKSTQEADNVFIIQRHVSKTNETVFFIDIKKNRFKGSLGRIPYL
YNKENMTIKEMSIGYLNDAISSRGYGSNGTAPSSASSAASSSSSNFVPSVGLPRDGLDFT
LCDEYDYMKQLADEYESKHAVRRYRVVADGRVSGVGSESTNSPNASSSNRAQNESKSDSG
SVDSSHNNQNKDNKSVDQVSGAEDDPTSNNRVVSASSKSEKGTIKNLLKGADRGGTATPV
GKNPKSDKPSGDSIHVVTPANSNGEKQEAPPDDVSKQNVSSYRLSAEGIIKLCEEIKENK
NEKLKDRVITISMRNCVINEDSTIKDIRNFIKTNKLNIKTAGKNLKKVDVFIAILQSIPK
EYITIKYGGGDVEKGDPDNNSVGSRSGENVKRGKLNSTLAGNHNNVSIGGSPSCVVPIRG
PTKNDLNIVPTVQEASVNNHNITHSSSGYVSAPRKGDAQSGEKHYSEEIKSLYGEEVTKR
YIQDNIINVDDNIVKRSGIFKLEGDNKIMSSEKLEYYEPVKKFDDDIESRFFLINDNNYN
EKINLIYKNVTYCGLDIETTGLEVFDEKIRLIQIAVEDYPVIIYDMFNITRESILSGLRE
ILRNEKVVKIIQNGKFDAKFLMHNNFEVNNIFDTYIASKLLDKNKNMYGFKLNNIVEKYL
NVTLDKQQQNSVWNNSLLNNNQLFYAARDSSCLLKLYKKLKSEICRENMETVNDIENKCI
LPICDMELNGIKVDLESLSKSTNEILSELNAETSKLKTELKDEEINVNSQQQVLKALQNN
NVRDVSNKLIENTSDANLKNFLNHREVVLLRNYRRLYKLYSAFYLKLPQHINKKTNKIHT
TFNQLKTFSGRFSSEKPNLQQIPRQKNIREIFIPQENNIFIIADFKQIELKIAAEITNDD
IMLKAYNNNIDLHTLTASIITKKAIADINKEDRHIAKAINFGLIYGMNYVNLKNYANTYY
NLNMNLDQCLYFYNSFFEHYKGIYRWHNQIKQMRALEYSTLSNRKVIFPYFSFTKALNYP
VQGTCADILKLSLVELYKNLRPINGKIILCVHDEIIIEVDKKYQEDALKILVESMENSAS
FFLKKVKCEVSVKIAQNWGSKE
NT seq 5649 nt NT seq  +upstreamnt  +downstreamnt
atgccaatagttgctaaaacgcgtatgcagcagagcgccaatttagcacaaggcgaatcg
ctgcatgctgcgtacgagcgtgaatatatgccacttcgaaataaaagtaggccgaaaaca
gatttttacttgaagacgaattgcgagttggtgaggaggcgaaagaatggctcgaaggta
tatttcaaaaggaaggcgcgaggtgaggattggggttctcgggcttgctatgacccgcgg
agaggggggagatacagccacagcagtggcgggaaccgccgcaaccgaagcaaccgcgac
agcggcgcgctgcgtgccacgagcactttcgtgtccaagtactacaaaataaacataaac
gacgtgtacagctacctgaataggaagaagtatgagtatatagaaacagacgtgaagata
acgctcaagtactgccccttctgcccgccacacaagtataaatatgacaatatgtacaag
catgaaatttttaaaaacaccggaaatagttactgccacagatgtgggtataaagggagc
ttctacgatttcaaactaaaaatgggagacttggtaacaagcaatttcgaaaacagtgtt
gtaagcaatacctatgaggaggaaaaaataagcttcaacgatgttaaggtgtatagcatg
aatttgttgtactcgaaggaggcagaagcggcaaggaaatatttaatcgaagaaagaaag
ctaaatttacaaacgctaaaaaagtattatgtaggattttctatcatggaatttcagtcg
ctagaaaattcaggaaaatttgaaaaacacgaatgcttaattttcccctttataaaaaaa
gcgaatgatctgaactccatggggttaaatggaaataaaaacaacacgaatgaaaaagac
tcgtacgaaattgtccgcataaaggtaagaagcttaagggataaaggatacatgagatta
taccccaagaatgtgaaagacgaaatgaaattattcttttttggagaccatttggttagt
aattccgaagaggttgtcctaacagaaggggagatagatgccatgactgtaagtcaggag
acgaattatgctgccatttctctgccaaatggttcgaagtcgcttcctatatatttgttg
ccatatttggaaaggttcaaaaaaatacatctgtggctcgattttgacaaggccgggaaa
tccagcgtctttaattttgtcaataaaattggactagggaggacgaacgtaataaccgat
gcgaatgtgcactatctcgatgaacagctgttcgagagaaagaggaaaaatttgttaact
aaagggggtctcctcttacccctaacagttggtgataaccccatcggcgtagcggagcag
aaacagggtggtattaaagaaaatacgcaaagtgacgaaaaaaatgggcacactgaaggc
acgcaggatggaaagggacccaacacagatgtagatccaatgtcaggtacaaacaaatca
gatttgaaaatagcagaaaaggcgaaaaatgaaggtgatagcagaaacaatcccagttgt
ggtgacacgggaaatacccaaggggaggcgcaaaaaaaagagagagaagaagaaggatgc
aaagcacgaacgttccactttgtacagaacaatatcatgtatataccaaacaacatcgtt
gtgaaggatgccaatgactgtctaaagcacaacatagatatacgattttttatagaaaat
agcgaaaaggtaaagcatagccaaatattaaacttcaatgatttgagacaaaatattttg
gaagaattaaaatatccggatagaataaatggaattaagagtaagactattccatcctta
aataaatttctatatggattacgcatgggagaattatccatatggacaggcccaacaggg
gtagggaaaactacccttttgtctcaactctcgctagattattgcatccaaggggtatct
accctatgggggtccttcgaaattaataacataaaattaggaaaagtaatgttaaatcaa
ttttgtggaaaaaatctagaaaaaaatattgacctatttgatctatatgcagataaattt
gaattattgccgctaaaatttttaaagtttcatggaagtacaaatatcgaccaagttttg
gatgccatggattatgcagtatatgcctacgatgtgaagcatatcattattgacaactta
cagttcatgttaaatataaataaattttctgacatatatgaactacagaacattgctatt
gataagtttagatcgtttagcacaaataagaatgtccacatcactttggttgttcaccca
aggaaggaggacaacaatcttctttccattgcctccgtttttggtagcgtcaaatctaca
caggaagccgataacgtgtttatcattcagagacatgtgtctaaaacgaatgaaactgtt
ttttttatagacattaaaaagaacagattcaaggggagcttgggtagaatcccctacttg
tacaataaagaaaatatgaccattaaggagatgtccattggctacttaaatgatgccatt
tcgagcaggggctacgggtccaatggcaccgccccttcttctgcttcttctgctgcttct
tcttcttcatctaattttgtgccgagcgttggtctccctcgcgatggcctggacttcacc
ctgtgcgatgagtacgactatatgaagcagttggccgacgagtacgaatcaaagcacgcc
gtgcgcaggtaccgcgttgtcgcagatggtagggttagcggtgtggggagtgaaagtacg
aacagccctaacgcttcctcctcgaaccgtgcccaaaacgaaagtaagagcgatagcggc
tcggtggactcctcgcacaataaccaaaataaagataacaagtcagtcgatcaagtaagc
ggcgcagaggatgaccctaccagtaataaccgcgtagttagtgcaagcagcaagagcgaa
aagggaaccataaaaaacttattgaagggagccgatcgaggaggcacagcaacccctgta
ggaaaaaatccaaaaagtgataaaccaagtggtgatagcatccatgtggtcacccctgct
aactcgaacggggagaagcaagaagcacccccagatgatgtatccaagcaaaatgtatca
tcctaccgattgagcgccgaagggataataaaactatgtgaagaaataaaagaaaacaaa
aatgaaaagctaaaagatagagtgataaccatatcaatgaggaactgtgttataaatgaa
gattcaacgataaaggatattcgaaactttataaagacaaacaagttaaacataaaaact
gctgggaagaatctaaaaaaggtagacgtttttatagccattttgcagagtattccgaag
gagtacataacgattaagtatggaggaggagacgtggagaaaggggatccggacaacaac
agtgtagggagcagaagtggtgaaaatgtgaaacgaggcaaactcaatagcacgctcgca
ggaaatcataacaatgtgagcattggaggtagcccttcctgcgtagtaccaattaggggg
cccaccaagaatgatctcaacattgttccgactgtgcaggaagcctctgtgaataaccat
aacattacgcatagttcaagtggctatgtgagtgccccccgaaaaggggatgcccagtcg
ggagagaagcactacagtgaagagataaaatcgctatacggggaagaagttacaaaaagg
tatatccaggacaatataatcaacgtagacgacaacattgttaagcggagtggaatattc
aaattggaaggggacaacaaaattatgagtagcgaaaagttggagtactacgaaccagtg
aaaaaattcgatgacgatattgagtctagattttttctcataaatgacaataattacaac
gagaagattaatcttatctacaagaacgtaacgtactgcggattagacattgagacaacc
gggcttgaggtattcgacgaaaagatccgcctcatccagatcgccgtggaggattaccca
gtgatcatttacgatatgtttaacataacgagggagagcattttgagtggcttgcgagaa
atcctaagaaatgaaaaagtggtgaaaattatacaaaatggcaaatttgacgcgaaattc
ttaatgcacaacaattttgaagtgaacaatatattcgacacgtacatagctagcaagctt
ttagacaaaaataaaaatatgtacggatttaagctgaacaatattgtagagaaatattta
aatgtaaccctagacaagcaacagcaaaatagtgtttggaataattcgctgttgaacaat
aaccaactgttttacgcagcaagagactccagctgtttactcaagttatacaaaaaattg
aagtccgaaatttgtagggaaaatatggaaactgtgaacgatattgaaaataagtgcatt
ttgcccatttgtgatatggagcttaatggcatcaaggtagacctggagagcttgagcaaa
agtacgaatgaaattttgagcgaattaaatgcagagacgagtaaattgaagacagagctg
aaggacgaagaaattaacgtaaactcgcagcaacaggtgctaaaagcattacaaaataat
aacgtgagggatgtttcaaataagcttatcgaaaatacttctgacgcaaacttgaagaat
ttcctcaatcatagggaagtagtcctactaagaaattacagaagattgtataaactgtac
tccgccttttacttaaagctaccacaacacataaacaaaaaaacgaacaaaatacacacg
acatttaatcagttaaaaactttctccggcagatttagcagtgagaaacccaatttacag
caaatcccaaggcagaaaaatataagggaaattttcataccgcaagaaaacaacatattt
ataatagccgactttaagcaaattgagctaaagatagctgccgaaattaccaatgatgat
attatgctcaaagcgtacaataacaacatcgatctgcacacactcacagctagcattatc
acgaagaaggccatagctgatataaataaggaagacaggcacattgccaaggccataaac
tttgggttaatctacggaatgaattacgtcaatctgaaaaattatgcaaacacatattac
aacctaaatatgaacctcgatcaatgcctttatttttacaactccttttttgagcactat
aaggggatatacagatggcataatcaaataaaacaaatgagggccttagagtattctact
ctttccaacagaaaagtcatattcccctacttttccttcaccaaggcgttgaattaccca
gtgcagggcacctgtgctgacattttgaaactgtccttagttgagctgtataaaaatttg
agacccatcaatgggaagatcatcctatgtgtccacgatgaaattataatcgaggttgac
aaaaaatatcaggaggatgccttaaaaatcctcgtggaatcgatggaaaattccgcatcg
ttctttttgaaaaaagtcaagtgcgaagtttccgtgaaaattgcgcaaaactggggctcc
aaggagtag

DBGET integrated database retrieval system