KEGG   Pseudomonas chlororaphis PCL1606: PCL1606_04260Help
Entry
PCL1606_04260     CDS       T03768                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
pcz  Pseudomonas chlororaphis PCL1606
Pathway
pcz00030  Pentose phosphate pathway
pcz01100  Metabolic pathways
pcz01110  Biosynthesis of secondary metabolites
pcz01120  Microbial metabolism in diverse environments
pcz01130  Biosynthesis of antibiotics
pcz01200  Carbon metabolism
pcz01230  Biosynthesis of amino acids
Module
pcz_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pcz_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:pcz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PCL1606_04260
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    PCL1606_04260
Enzymes [BR:pcz01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     PCL1606_04260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C TPP_enzyme_C E1_dh DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: AKA21881
UniProt: A0A0D5XS14
LinkDB All DBs
Position
453052..455049
Genome map
AA seq 665 aa AA seqDB search
MPSRRERANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWRDYLKHNPSNPSFADRDRF
VLSNGHGSMLIYSLLHLTGYDVTIDDLKSFRQLHSRTPGHPEFGYTPGVETTTGPLGQGL
ANAVGFALAEKVLAAQFNRPGHNVVDHHTYVFLGDGCMMEGISHEVASLAGTLGLGKLIA
FYDDNGISIDGEVEGWFTDDTPKRFEAYNWQVIRNVDGHDPEEIKIAIDTARKSEQPTLI
CCKTTIGFGSPNKQGKEDCHGAPLGAEEIALTRAALKWNHGPFEIPADIYAEWDAKEAGR
AVEADWDQRFAAYSAEFPELANELVRRLSGELPADFAEKADAYIAEVAAKGETIASRKAS
QNALNAFGPLLPEFLGGSADLAGSNLTLWKGCKGVSAEDASGNYMYYGVREFGMTAIMNG
VALHGGLVPYGATFLMFMEYARNAVRMSALMKQRVIHVYTHDSIGLGEDGPTHQPIEQIA
SLRTTPNLDTWRPADAVESAVAWKHAIERKDGPSALIFSRQNLQHQTRDAAQIAQISRGG
YVLKDCAGEPELILIATGSEVGLAVQAFDKLTEQGRKVRVVSMPCTSVFDAQDAGYKQSV
LPLQVSARIAIEAAHADYWYKYVGLEGRVIGMTTYGESAPAPALFEEFGFTLDNILGQAE
ELLED
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgccaagccgtcgtgagcgtgccaacgccattcgtgccctcagcatggatgccgtgcaa
aaagccaacagcggccatccgggtgcccccatgggtatggcggatatcgccgaagtactt
tggcgtgactacctcaagcacaacccgagcaatccgtccttcgccgaccgcgaccgcttc
gtgctgtccaacggccacggctcgatgttgatctactcgctgctgcacctgaccggctac
gacgtcaccatcgacgacctgaagagcttccgccagctgcacagtcgcaccccgggccac
ccggaattcggctataccccgggcgtcgagaccaccaccggcccgctgggccagggcctg
gccaacgctgtgggcttcgccctcgcggaaaaagtcctggcggcgcagttcaaccgtccc
gggcataacgtcgtcgaccaccacacctacgtgttcctgggcgatggctgcatgatggaa
ggcatttcccacgaagtcgcttccctggccggcaccctgggcctgggcaagctgatcgcc
ttctacgatgacaacggcatctccatcgacggcgaagtcgaaggctggttcaccgacgac
acgccgaagcgtttcgaagcctacaactggcaggtgatccgcaacgtcgacggtcacgac
ccggaagaaatcaagatcgcgatcgacaccgcgcgcaagagcgagcagccgaccctgatc
tgctgcaagaccaccatcggcttcggttcgccgaacaagcagggcaaggaagattgccac
ggtgcgccactgggggccgaggaaatcgccctgacccgcgccgcgctgaagtggaaccac
ggcccgttcgaaatcccggccgacatctacgccgagtgggatgccaaggaagccggccgc
gccgtcgaggccgactgggaccagcgtttcgccgcctactccgccgagttccccgaactg
gccaacgagctggtgcgtcgcctgagcggcgagctgccggccgatttcgccgagaaggcc
gacgcctacatcgccgaagtcgcggccaagggcgaaaccatcgccagccgtaaagccagc
cagaacgccctgaacgcgttcggcccgctgctgccggaattcctcggcggttcggccgac
ctggccggttccaacctgaccctgtggaaaggctgcaagggcgtcagcgccgaggacgcc
agcggcaactacatgtactacggcgtgcgcgagttcggcatgaccgcgatcatgaacggc
gtggccctgcacggcggcctggtgccttacggcgcgaccttcctgatgttcatggaatac
gcccgcaacgcggtgcgcatgtcggccctgatgaagcagcgcgtgatccacgtctacacc
cacgactccatcggcctgggcgaagacggtccgacgcaccagccgatcgagcagatcgcc
agcctgcgcaccacgccgaacctcgacacctggcgtccagccgatgccgtggaatcggcc
gtggcctggaaacacgcgatcgagcgcaaggacggtccttcggcgctgatcttctcccgc
cagaacctgcagcatcagacccgcgacgcggcgcagatcgcccagatcagtcgtggcggc
tacgtgctcaaggactgcgcgggcgagcctgagctgatcctgatcgccaccggttccgaa
gtcggcctggcggtgcaggccttcgacaagctgaccgagcagggccgcaaggtgcgcgtg
gtgtccatgccatgcaccagcgtgttcgatgcccaggacgccggctacaagcagtcggta
ctgccgctgcaggtcagcgcccggatcgccatcgaggccgcccacgcggactactggtac
aagtacgtcggcctggaaggtcgcgtcatcggcatgaccacctacggcgagtcggccccg
gcgccagccttgttcgaagagttcggtttcaccctggacaacatcctgggccaggccgaa
gagctgctggaagactaa

DBGET integrated database retrieval system