KEGG   Pseudomonas chlororaphis PCL1606: PCL1606_19760Help
Entry
PCL1606_19760     CDS       T03768                                 

Definition
(GenBank) peptide synthase
Organism
pcz  Pseudomonas chlororaphis PCL1606
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C AMP-binding_C_2 AATase
Motif
Other DBs
NCBI-ProteinID: AKA23431
UniProt: A0A0D5XWG1
LinkDB All DBs
Position
2051212..2064225
Genome map
AA seq 4337 aa AA seqDB search
MDAFELPSTLAQALQRRAAQTPDQVALRFLAEEQDQNVVLSYSDLDRRARTIAAALQANA
GLGDRAVLLFPSGPDYVAAFFACLYAGVIAVPAYPPESSRRHHQERLISIIADAEPRLLL
TSSGLRDSLAQTDALQGAAAPQLLCVDSLPASLAEGWSPIELQGDDIAFLQYTSGSTALP
KGVQVSHGNLVANELLIRRGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVLM
SPAYFLGRPLRWLEAISEYGGTISGGPDFAYRLCSERVSESALERLDLSRWRVAYSGSEP
IRLDTLERFAEKFAACGFTPNQFFASYGLAEATLFVAGGTRGQGIPALRLDEQALAQNRA
EPGNGNAMMSCGTSQPEHAVLIVEPNTLAELEENRVGEVWAAGPSIAHGYWRNPEATAKT
FVQHAGRTWLRTGDLGFMRGGELFITGRLKDMLIVRGHNLYPQDIEQTIEREVEVVRKGR
VAAFAVSDQGQEGIGIAAEISRSVQKILTPDALIKLIRQTVAEAYQEAPSVVVLLNPGAL
PKTSSGKLQRSACRNRLADGSLDSYAVFPDRQAAKSEAGGDTASALQDLVGRIWREQLQV
EQVAGDDHFFLLGGNSIAATQVVARLREELDLELNLRLLFEAPTLGAFAARVAQLQQDGG
LAQGAINTLPRSEALPQSLAQNRLWITWQLDPQSSAYNIPGGLRLRGELDQDALRASFQH
LIERHESLRTRFFERDGQALQQVLPAGEFDLRTIDLSDLPPAEREARAQQIREDEACTRF
DLEQGPLLWVTLVRLDDEEHLLLVTLHHIIADGWSLNVLIDEFSRLYAGASQGQAVALAP
LPLQYADYGSWQRQWLAEGEGERQLAYWKQQLGDEHPSLGLATDHPRSAQQQHSAARHSL
RLGASLSEAIRQTAQAHEATPFMLLLTAFQSLLHRYSGQRDIRIGVPNANRPRLETQGLI
GFFINTLVLRAEVQGRLPFVELLAHTRQAALQAQAHQDLPFEQLLEAFPQAREQGLFQVM
FNHQQRDLSALRRLPGLLAEELPWHSREAKFDLQLHSEEDRNGRLSLSFDYASELFEAAT
IERLAEHFVSLLRAACERPQTAIADLPLLNPCEQAQLHQWGEAPCAPASQWLPELLEHQA
QLTPERTALLWEGGELSFAELHAQANRLAHYLRDKGVGPDVCVAIAAERSPQLLIGLLAI
VKAGGAYVPLDPDYPAERLAYMLADSGVALLLTQTHLLERLPRAAGVSAIAMDSLKLDNW
PSHAPGLHLHGDNLAYVIYTSGSTGQPKGVGNTHAALSERLQWMQDTYRLDASDVLMQKA
PISFDVSVWECFWPLITGCRLLLAAPGEHRDPYRIAQLVQHYGVTTLHFVPPLLQLFVDE
PLAAGCSSLRRVFSGGEALSAELRDRLLAQLPDTQLHNRYGPTETAINVTHWQCRSSDGE
RSPIGRPLGNVICRVLDADLNPVPAGVPGELCIAGSGLARGYLGRPGLSAERFVVDPLST
EGARLYRTGDRVRWGADGALEYLGRLDQQVKLRGFRVEPQEIEARLLAQAGVAQAAVLVR
ETAAGAQLIGYYTASVAGEDEAAQNERLKTALASELPEYMVPAQLLRLDAMPLSPSGKLD
RRALPEPQWQVREHVEPVTELQRQIAAIWREVLGQQRIGLRDDFFALGGHSLLATQIISR
TRQACDVELPLRALFEASELGDFAQQVRLIQEAGQRNQQLSIAKVDRSAPVPLSYSQQRM
WFLWQMEPDSPAYNVGGMARFKGVLDVGRFEAALQALILRHETLRTTFPSVDGVARQRVH
AETGVRMAWKDFSALDAASREQRLQQLADSEAHLPFDLETGPLLRACLVKAAEQEHYFVL
TLHHIVTEGWAMDIFARELSALYEAFVDDRDSPLEPLPVQYLDYSVWQRQWLESGERQRQ
LDYWTAQLGHEHPLLELPGDRPRPPVQSHQGELYRFDLSDELAARVRRFNAENGLTLFMT
MTATLALLLYRYSGQTDLRIGAPVANRIRPESEGLIGAFLNTQVLRCRLDGQMSVGELLE
QVRHTVIEGQSHQDLPFDHLVEALQPPRSAAYNPLFQVMCNVQRWEFQQSRTLAGMTVEY
LANDARATKFDLNLEVTDLDHRLGCCLTYSTDLFDEPRIARMAAHWRNLLEALLADPERR
LSELPLLDSAEQQQLLDSLGVEPGAHRLDQCIHHLFSEQALLRPDAPALTFAGQTLSYAE
LDGRANRLAWMLRERGVGPQVRVGLALERSLEMVVGLLAILKAGGAYVPLDPEYPLDRLH
YMIEDSGIGLLLSDAAMFAALGELPPTVARWCLEEDGARLADYPAGELPFISLPQHQAYL
IYTSGSTGKPKGVVVSHGEIAMHCRAVIERFGMRPDDCELHFYSINFDAATERLLVPLLS
GAQVVLRAQGQWDAEAICQLIREHRINILGFTPSYGSQLAQWLATQGQTLPVRMCITGGE
ALTGEHLSRIRAAFKPSLFFNAYGPTETVVMPLASLAPQQLEEGAGSVPIGTVIGDRVAY
ILDADLALVPQGATGELYVGGAGLAQGYHQRPGMSAERFVADPFSAQGGRLYRTGDLVRQ
CADGQVEYIGRVDHQVKIRGFRIELGEIESRLLEHDAVREAVVLALDMPGGKQLAGYLVT
DVAEQGDEAQAELREALKAQLKTQLPDYMVPTHLILLASMPLTANGKLDRRALPAPDLEL
NRQQYVAPSSELERTLAQIWCEVLNLSQVGLHDNFFELGGDSILSIQVVSRARQQGIHFS
PRDLFQHQTVQTLAAVASRSEQIVAEQGLLSGESGLTPIQHWFFDSEIAERHHWNQALLL
EPTQALDARRLEQALQQVLAQHDALRLRFTQVAGQWQAEHQPLAEAPLLVPLRVDSMEQC
TALFAEAQRSLDLGHGPLWRALLVDGPDGQQRLFIAIHHLVVDGVSWRVLLEDLQSVYRQ
LEAQQTPRLPAKTSALRDWASRLLAYAGSESLREESSWWQDQLAGPTVALPVQNADGGQQ
NKHARSVSVTLDAERTRQLLQQAPSAYRTQVNDLLLTALARVLCRWTGEASALIQLEGHG
REALFDEIDLTRTVGWFTSAYPLRLTPVAVEAAAGQGASIKAIKEQLRAVPHKGLGYGVL
RYLAEATIRQGMAALPQAPVTFNYLGQFDQSFAGDALFRPLDEPLGAAHSPEAPLPNELS
VDSQVYAGQLVLRWTFSGERFDVQTIDALAQAYLDELHSLIAHCLQDEAGGLTPSDFPLA
RLTQAQLDALPVPASVIEDVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSELDPERF
ARAWQAVVARHEALRASFCWNVGEAMLQVIHKPGSTPLEYLDWSAVAEAEQEPKLQALLK
SEREAGFDLLNQAPFHLRLIRVGAARYWFMMSNHHILIDAWCRSLLMNDFFEVYTALGEG
REAQLAVPSRYRDYIGWLQRQSLAEARQWWQDNLRGFERTTPIPSDRPFLREHAGDSGGM
LVGDCYTRLDARDGAQLRELAQQHQLTVNTFAQAAWALVLRRLSGDRDVLFGVTVAGRPV
EMPQMQRTVGLFINSIALRVKLPEDGQRCGVRQWLSGLLDSNMQLREYEYLPLVAIQESS
ELPKGQPLFDSLFVFENAPVEVSVLDRAQSLNATSDSGRTHTNFPITAVCYPGDDLGLHL
SYDQRYFERATIERMLGEFKRLLLALVQGFHGDMAELPLLGEEEQDFLLAGCNQSARDYP
LQRSYVELFEAQVAAHPQRIAASCQDLQYSYAELNQRSNRLGHALIAQGVGLDQPVALLA
ERGLDLLGMIIGSFKAGAGYLPLDPGLPGQRLARIIELSRTPLLVCSAACLEQARALLDE
FACANRPRLLVWDEVQAGGHSPENPGVYSGPDNLAYVIYTSGSTGLPKGVMVEQRGMLNN
QLSKVPYLQLSEADVIAQTASQSFDISVWQFLAAPLFGARVDIVPNTIAHDPQGLLAHVQ
AQGVTVLESVPSLIQGMLAQDSIDLDSLRWMLPTGEAMPPELAHQWLLRYPQIGLVNAYG
PAECSDDVAFYRVDMASTRGSYLPIGTPTDNNRLYLMDGALQLVPLGAVGELCVAGTGVG
RGYVSDPLRTAQVFVPHPFGAPGERLYRTGDLARRRADGVLEYVGRIDHQVKIRGYRIEL
GEIEARLHEQPEVRDAAVGVQEGVNGKHLVGYLVASDSALSPSERLERIKQRLRAELPEY
MVPLHWLWLERLPLNANGKLDRKALPALEIGQLQSTDYLAPRSELEQTLAAIWAEVLKVE
QVGVHDNFFELGGHSLLATQIASRVQKALQRNVPLRAMFECSTVEELAHYIDGLANSEIN
EEKVDRLSDLMAELEGL
NT seq 13014 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgttcgaactccccagcactctggctcaagcccttcaacgccgggcggcgcag
acccccgatcaagtggccttgcgctttcttgccgaagagcaggatcagaacgtggtcctc
agctacagcgacctggaccggcgcgcccggaccatcgccgcggccctgcaagccaacgcc
ggcctgggcgatcgcgcggtgctgctgttccccagcggcccggactatgtcgcggccttt
ttcgcctgcctgtatgccggcgtcatcgcggtgccggcctatccgccggagtcgagccgg
cgccatcaccaggaacggctgatctcgatcatcgccgacgccgagccgcggttgctgctg
accagcagcgggttgcgcgactccctggcgcagacggacgcgcttcaaggcgccgctgcg
ccgcagctgctctgcgtggacagcctgccagccagcctggccgaaggctggagccccatc
gaactgcagggcgacgacatcgccttcctgcaatacacctccggttccaccgcgttgccc
aagggcgtgcaagtcagccacggcaacctggtggccaacgagctgctgatccgccgcggc
ttcggcatcgacctcaacccggacgatgtgatcgtcagctggctgccgctgtaccacgac
atgggcctgatcggcggcctgttgcagccgatcttcagcggcgtgccctgcgttttgatg
tcgccggcctatttcctcggccggccgttgcgctggctggaggcgatcagtgaatacggc
ggcaccatcagcggcggcccggacttcgcctaccgcctgtgcagcgagcgggtcagcgag
tcggccctggaacgcctcgacctcagccgctggcgcgtggcctattccggttccgagccg
atccgcctggacaccctggagcgcttcgccgagaagttcgccgcctgcggtttcaccccg
aatcagttcttcgcttcctatggcctggccgaagccaccctgttcgtcgccggcggcacc
cgcggccagggcatcccggccctgcgcctggacgagcaggccctggcgcagaaccgcgcc
gagccgggcaacggcaacgccatgatgagctgcggcaccagccagcccgagcacgcggtg
ctgatcgtcgagcccaacaccctggccgaactggaagagaaccgggtgggcgaagtctgg
gccgctggtccgagcatcgcccacggctactggcgcaaccccgaggccacggccaagacc
ttcgtccagcacgccggccggacctggctgcgcaccggcgacctgggcttcatgcgcggt
ggcgagctgttcatcaccggccgcttgaaagacatgctaatcgtgcgcgggcacaacctt
tatccacaggacatcgagcagaccatcgagcgggaagtcgaggtggtgcgcaagggccgg
gtcgcggcgttcgccgtcagcgaccagggccaggaaggcatcggcatcgccgcggaaatc
agccgcagcgtgcagaagatcctcacgcccgacgcgctgatcaaactgatccgccagacc
gtggccgaggcctaccaggaagcgccgagcgtggtggtattgctcaaccccggcgcgttg
cccaagacctccagcggcaagttgcagcgctccgcctgccgcaaccgcctggccgatggc
agcctcgacagctatgcggtcttccccgaccgccaggcggcgaagagcgaggccggcggc
gacaccgccagtgcactgcaagacctggtcggccgcatctggcgcgagcagctgcaggtc
gagcaggtggcgggcgacgaccacttcttcctgctgggcggcaactccatcgccgcgacc
caggtggtggcacgtctgcgcgaagaactcgacctggagctgaacctgcgcctgctgttc
gaggcgccgaccctgggggccttcgccgcccgggtggcgcagctgcaacaggacggcggc
ctggcccagggcgccatcaacaccttgccgcgcagtgaagcactgccgcagtccctggcg
cagaaccgtctgtggatcacctggcagcttgacccgcagagcagcgcctacaacattccc
ggcggcctgcgcctgcgcggcgagctggaccaggacgccctgcgcgccagcttccagcac
ctgatcgagcgtcacgaatccctgcgcacgcggtttttcgagcgcgacggccaggcgctg
caacaggtgctgccggccggcgaattcgacctgcgcacgatcgacctcagcgacctgccg
ccggccgagcgcgaggcacgggcgcagcagatccgcgaggacgaggcctgcacccggttc
gacctggagcagggcccgttgctgtgggtgaccctggtgcgcctcgacgacgaggaacac
ctgttgctggtgaccctgcaccacatcatcgccgacggctggtcgctgaatgtgctgatc
gacgagttctcgcggctgtatgccggcgcgtcccagggccaggcggtggcgttggcgcca
ttgccgttgcagtacgccgactacggcagctggcagcgccagtggctggccgagggcgaa
ggcgagcggcagttggcctactggaaacagcagttgggcgacgagcacccgagcctgggc
ctggccaccgatcacccgcgttcggcgcaacagcaacacagcgccgcgcgccacagcctg
cgcctgggggcgagcctgagcgaggcgattcgccagaccgcccaggcccatgaagcgacg
ccgttcatgctgttgctcacggcgttccagagcctgctgcatcgctacagcggccagcgc
gatatccgcatcggcgtgcccaacgccaaccgcccgcgcctggaaacccagggcctgatc
ggcttctttatcaacaccctggtgctgcgcgccgaggtgcaaggccgcctgccattcgtc
gagctgctggcgcacacccgccaggccgcgttgcaggcccaggcccaccaggacctgccg
ttcgagcaactgctcgaagccttcccccaggcccgggaacaggggctgttccaggtcatg
ttcaaccaccagcagcgcgacctcagcgccttgcgccgcttgcccgggctgctggccgaa
gaattgccgtggcacagccgcgaggccaagttcgacctgcaactgcacagcgaggaagac
cgcaacggtcgcctcagtctgtccttcgactacgccagcgagctgttcgaggccgcgacc
atcgagcgcctggccgagcatttcgtcagcctgctgcgcgccgcctgcgagcgtccgcaa
accgccatcgccgatctgccgttgctcaacccctgcgagcaggcgcagctgcaccagtgg
ggcgaagcgccgtgcgcgccggccagccagtggctgccggagctgctggagcaccaggcg
caactgaccccggagcgcaccgcgctgctgtgggagggcggtgagctgagcttcgccgag
ctgcacgcccaggccaatcgcctggcccattacctgcgggacaagggcgtcggcccggat
gtgtgcgtggctatcgccgccgagcgttcgccgcaactgctgatcggcctgctggcgatc
gtcaaggccggcggcgcctatgtgccgctggacccggactacccggccgagcgcctggcc
tacatgctggccgacagcggcgtcgcgctgctgctgacccagacccacctgctcgaacgc
ctgccccgagccgcgggcgtcagcgccatcgccatggacagcctcaagctcgacaactgg
ccgagccacgcgccaggcctgcacctgcacggcgacaacctggcctatgtgatctacacc
tccggttccaccggccagcccaagggcgtgggcaacacccacgcggccctgagcgaacgc
ttgcagtggatgcaggacacttaccgcctggacgccagcgacgtgctgatgcaaaaggcc
ccgatcagcttcgacgtgtcggtgtgggagtgcttctggccgctgatcaccggctgccgc
ctgctgctggcggcgccgggcgagcaccgcgatccgtatcgcattgctcaattggtgcag
cactacggcgtgaccacgctgcacttcgtgccgccgctgttgcagctgttcgtcgacgag
ccgctggccgctggatgcagcagcctgcgccgggtgttctccgggggcgaagccctgtcg
gccgagctgcgcgaccgcctgctggcgcagttgcccgatacccagctgcacaaccgctat
ggcccgaccgaaaccgcgatcaacgtcacccactggcagtgccggagcagcgatggcgag
cgttcgcccatcggccgtccgctgggcaacgtgatctgccgggtgctggacgccgacctc
aacccggtgccggccggggtgccgggcgagctgtgcattgccggcagcggcctggcccgg
ggttacctcgggcggccggggttgagcgccgagcgttttgtggtcgacccgctgagcacc
gagggcgcgcgcctgtaccgcaccggcgaccgcgtgcgctggggcgccgacggtgcgttg
gaatacctcggccgcctcgaccagcaggtcaagctgcgcggttttcgcgtcgaaccccag
gaaatcgaagcacggctgctggcccaggccggcgtggcccaggccgcggtgctggtgcgc
gagaccgcggccggcgcgcagttgatcggctactacaccgcgagcgtcgccggggaggat
gaggccgcgcagaacgagcgcctgaaaaccgccctggccagcgagctgccggaatacatg
gtgccggcgcaattgctgcgcctggacgccatgcccctgagcccgagcggcaagctcgac
cgccgcgccttgcccgagccgcagtggcaggtacgcgaacatgtcgagccggtgaccgag
ctgcaacggcagatcgcggcgatctggcgcgaggtgctgggtcagcaacgcatcggcctg
cgcgacgacttcttcgccctgggcggccactcgctgctggcgacccagatcatttcccgt
acccgccaggcctgcgacgtcgagctgccgctgcgggcgctgttcgaagccagcgagctg
ggcgacttcgcccagcaggtgcggctgatccaggaagccggccagcgtaaccagcagttg
tcgatcgccaaggtcgaccgcagcgcgcctgtgccgctgtcgtattcccagcagcgcatg
tggttcctctggcagatggagccggacagcccggcctacaacgtcggcggcatggcgcgc
ttcaagggcgtgctggatgtcgggcggttcgaggcggcgttgcaggcgttgatcctgcgc
catgaaaccctgcgcaccactttccccagcgtcgatggcgtggcccggcaacgggtgcac
gcggaaaccggcgtgcgcatggcctggaaggatttctcggccctggatgccgccagccgc
gagcaacgcctgcaacagctggccgacagcgaagcgcacctgccgttcgacctggagacc
ggcccgctgctgcgcgcctgcctggtcaaggcggcggagcaggagcactacttcgtgctg
accctgcaccacatcgtcaccgaaggctgggcgatggacatcttcgcccgcgagctgagc
gcgctgtacgaagcctttgtcgacgaccgcgactcgcccctggaaccgctgccggtgcag
tacctggactacagcgtctggcaacggcagtggctggaatccggcgagcgccagcgccag
ctggattactggaccgcgcagctgggccacgaacacccgctgctggaactgccgggcgac
cggccgcggccgccggtgcaaagccaccagggcgagctgtaccgcttcgacctcagcgac
gagctggcggcgcgggtgcggcgcttcaatgccgagaacggcctgaccctgttcatgacc
atgaccgccaccctggcgctgctgctctatcgctacagcggccagaccgacctgcgcatc
ggcgcgccggtggccaaccgcatccgcccggaaagcgaagggctgatcggcgccttcctc
aatacccaggtactgcgttgccggctcgacgggcagatgagcgtcggcgagttgctggag
caggtgcggcatacggtgatcgagggccagtcccaccaggacctgccgttcgaccacctg
gtggaagccctgcaaccgccgcgcagcgccgcctataacccgctgttccaggtgatgtgc
aacgtccagcgctgggagttccagcagagccgcacgctggccggcatgaccgtggaatac
ctggccaacgacgcccgggccaccaagttcgacctcaacctggaagtcaccgacctcgac
catcgcctgggttgctgcctgacctacagcaccgacctgttcgatgagccgcgcatcgcg
cgcatggccgcgcactggcgcaacctgctggaagcgctgctggccgaccccgagcggcgc
ctgagtgagttgccgctgctcgacagcgccgagcaacaacagctgctggacagcctgggc
gtcgagcccggcgcgcatcgcctcgaccagtgcatccatcacctgttcagcgagcaggcg
ctgctgcgcccggacgccccggccctgaccttcgccgggcagaccctgagctacgccgaa
ctcgacggccgcgccaaccgcttggcctggatgcttcgcgagcgcggcgtcggcccgcag
gtgcgggtcggcctggccctggaacgttcgctggaaatggtcgtcggcctgctggcgatc
ctcaaggccggcggcgcctatgtgccgctggacccggaatacccgctggaccgcctgcac
tacatgatcgaagacagtggcatcggcctgctgctcagcgacgcggcgatgttcgccgcc
ctcggcgagctgccgccgactgtggcgcgctggtgcctggaggaagacggcgcacgactg
gccgactacccggccggtgagctgccgtttatcagcctgccgcagcaccaggcgtacctg
atctacacctccggttccaccggcaagcccaagggcgtggtggtgtcccacggtgagatc
gccatgcactgccgcgcagtgatcgagcgcttcggcatgcgcccggacgattgcgagctg
cacttctattcgatcaacttcgacgctgccaccgagcgcctgctggtgccgctgctcagc
ggcgcccaagtggtgttgcgcgcccaagggcaatgggacgccgaagcgatctgccaactg
atccgcgagcaccgcatcaatatcctcggcttcaccccgagttatggcagccagctggcg
cagtggctggcgacccagggccagacgctgccggtgcgcatgtgcatcactggcggcgag
gcactgaccggcgaacacctgagccggatccgcgcagcctttaagccgagcctgttcttc
aacgcctacggccccaccgagaccgtggtcatgccgttggccagcctggcgccgcagcaa
ctggaggagggcgcgggcagcgtgccgatcggcaccgtgatcggcgatcgcgtggcctat
attctcgacgctgatctggccctggtgccgcaaggcgccaccggcgagctgtatgtcggc
ggggccggcctggcccaggggtatcaccagcgcccgggcatgagtgccgagcgcttcgtc
gccgacccgttcagcgcgcagggcggccgcctgtaccgtaccggcgacctggtgcgccag
tgcgccgacggccaggtggaatacatcggccgggtcgaccatcaggtgaagatccgcggt
ttccgtatcgagctgggggaaatcgaaagccgcctgctggaacatgacgcggtgcgcgaa
gccgtggtgctggccctggacatgcccggtggcaagcagctggccggttatctagtgacc
gatgtcgccgagcagggcgacgaggcccaggcagagctgcgcgaggcgctcaaggcccag
ctgaaaacccagctgccggactacatggtgccgacccacctgatcctgctggcgagcatg
ccgctgaccgccaacggcaagctcgaccgccgcgccttgccggcgccggacctggaactc
aatcgccagcagtacgtggcgccgagcagcgaactggaacggaccctggcgcagatctgg
tgcgaggtgctgaacctgtcgcaggtcggcctgcacgacaacttcttcgagctgggcggc
gattcgatcctgtcgatccaggtggtcagccgcgctcgccagcagggtattcatttcagc
ccgcgggacctgttccagcaccagaccgtgcagaccctggccgcggtggccagccgcagc
gaacagatcgtcgccgagcaggggctgctcagtggcgagtcgggcctgacgccgatccag
cactggttcttcgacagcgaaatcgccgagcggcaccactggaaccaggccctgctactg
gagccgacccaggcactcgatgcccggcgcctggaacaggcgctgcaacaggtgctggcc
cagcatgacgccttgcgcctgcgtttcacccaggtggccggccagtggcaggctgagcat
cagccgctggccgaagcgccgctgctggtgccgctgcgcgtggactcgatggaacagtgc
acggcactgttcgccgaggctcagcgcagcctcgacctgggccacggaccgctgtggcgc
gccctgctggtggacggcccggacggccagcaacggctgtttatcgccatccaccacctg
gtggtcgacggcgtgtcctggcgcgtattgctggaagatctacagagcgtgtatcgccag
ctggaagctcagcagacgccgcgcctgccggcgaaaaccagcgccttgcgcgattgggcg
tcccgcctgctggcctatgccggcagcgagtcgctgcgcgaagagtcgagctggtggcag
gaccaattggccgggccgacggtggcgttgccggtgcagaacgccgatggcgggcagcaa
aataaacacgcccgcagcgtcagcgtgacgctcgacgccgagcgtacccggcagctgctg
caacaggcgccgagcgcctaccgcacccaggtcaacgacctgctgctgaccgccctggcc
cgcgtgctgtgtcgctggaccggcgaggcatcggccttgatccagctcgaaggccacggc
cgcgaagccctgttcgacgagatcgacctgacccgcaccgtcggctggttcaccagcgcc
tacccgctgcgcctgacgccggtggcggtcgaagcggcggccgggcagggcgcctcgatc
aaggcgatcaaggagcaactgcgcgccgtaccgcacaagggcctgggttatggcgtgctg
cgctacctggccgaggcgacgatccgccagggcatggcggccctgccgcaggcgccggtc
accttcaactacctggggcagttcgaccagagctttgccggcgacgcgctgttccggccg
ctggacgagccgctgggcgccgcccattcgcccgaggcgccgctgcccaacgagctgagc
gtcgacagccaggtctatgccggccagctggtgctgcgctggaccttcagcggcgaacgt
ttcgacgtgcagaccatcgacgcgctggcccaggcctacctcgacgaactgcacagcctg
atcgcccattgcctgcaagacgaggccggtggcctgacgccgtcggacttccccctggcg
cgcctgacccaggcgcagctggacgcgctgccggtgccggccagcgtgatcgaggacgtc
tacccgctgaccccgatgcaggaaggcatgctgctgcacaccctgctggaaccgggcacc
ggcctgtactacatgcaggaccgctaccgcatcaacagcgagctggaccccgagcgcttc
gcccgggcctggcaggcggtggtggcccgtcacgaagccctgcgcgcgtccttctgctgg
aacgtcggcgaagccatgttgcaggtgatccacaagccgggcagcacgccgctcgagtac
ctggactggagcgccgtggccgaggccgagcaggaaccgaagctgcaagcgctgctgaag
agcgagcgcgaggccggtttcgatctgctcaaccaggcgccgttccacctgcgcctgatc
cgcgtgggcgccgcgcgctactggttcatgatgagcaaccaccacatcctgatcgatgcc
tggtgccgttcgctgctgatgaacgacttcttcgaggtctacaccgccctcggtgagggg
cgcgaagcccagctggccgtgccgagccgctaccgcgactacatcggctggctgcaacgc
cagagcctggccgaggcgcgccagtggtggcaagacaacctgcggggcttcgaacgtacg
acgcctattccgagcgaccggccgttcctgcgcgaacacgccggcgacagcggcggcatg
ctggtcggcgactgctacacccgcctggatgcccgcgacggcgcgcaattgcgtgagctg
gcgcagcagcaccagctgaccgtcaacaccttcgcccaggcggcctgggccctggtcctg
cggcgcctgagcggcgaccgcgacgtgctgttcggcgtcaccgtggccgggcgtccggtg
gagatgccgcagatgcagcgcaccgtcggcctgttcatcaacagcatcgcgctgcgggtg
aaactgccggaagacggccagcgctgcggcgtgcgccagtggctcagcggcttgctggac
agcaacatgcagctgcgcgagtacgagtacctgccgctggtggcgatccaggaaagcagc
gaactgcccaagggccagccgctgttcgacagcctgttcgtgttcgagaacgcgccggtg
gaagtctcggtgctggatcgtgcgcaaagcctgaacgccacctcggattcgggccgtacc
cacaccaacttcccgatcaccgcggtgtgctacccgggggacgacctggggctgcacctg
tcttacgaccagcgttacttcgaacgcgcgaccatcgagcgcatgctcggcgagttcaag
cgcctgctgctggcgctggtgcagggcttccatggcgacatggccgagttgccgctgctg
ggcgaagaggagcaggacttcctgctcgccggctgcaaccagagcgcgcgggactatccg
ttgcagcgcagctacgtcgagctgttcgaggcccaggtggcggcgcatccgcaacgcatc
gccgccagttgccaagacctgcaatacagctacgccgagctgaaccagcgcagcaaccgc
ctcggccatgcgctgatcgcccagggcgtgggcctggaccagccggtggcgctgctggcc
gaacgcggcctggacctgttgggcatgatcatcggcagcttcaaggccggcgccggctac
ctgccgctggaccctggcctgccgggccagcgcctggcgcggatcatcgaactcagccgc
acgccgctgctggtgtgcagcgcagcctgcctggaacaggcgcgagccctgctcgacgaa
ttcgcctgcgccaaccggccgcggctattggtctgggacgaggtccaggcgggcggccat
tcgccggaaaacccgggcgtctacagcggcccggacaacctggcctacgtgatctacacc
tcgggctccaccggcctgccgaaaggcgtgatggtcgagcagcgcggcatgctcaacaac
cagctgagcaaggtgccgtacctgcaattgagcgaagccgacgtgatcgcccagaccgcg
tcgcagagcttcgatatctcggtctggcagttcctcgccgcgccgctgttcggcgcgcgg
gtggacatcgtgccgaacaccatcgcccatgacccgcaaggcttgctggcccatgtgcag
gcgcagggcgtcacggtgctggagagcgtgccgtcgctgatccagggcatgctcgcccag
gacagcatcgacctcgacagcctgcgctggatgctgccgaccggcgaggcgatgccgccg
gagctggcgcatcaatggctgctgcgttatccacagatcggcctggtcaatgcctacggt
ccggccgagtgctcggacgacgtggccttctaccgcgtcgatatggcctcgacccgcggc
agctacctgcccatcggcacgccgaccgacaacaaccgcctgtacctgatggacggcgcg
ctgcaactggtgccgctgggcgcggtgggcgagctgtgtgtggccgggaccggggtcggc
cgcggttatgtcagcgatccgctgcgcaccgcccaggtgttcgtgccgcatccgttcggg
gctccgggcgaacgcctgtaccgcaccggcgacctggcccgacgccgcgccgatggcgtg
ctggagtacgtcgggcgcatcgaccatcaggtgaagatccgcggctaccgcatcgagctg
ggggaaatcgaagcgcgcctgcacgaacagccggaagtccgggacgcggcggtgggcgtg
caggaaggggtcaatggcaagcacctggtgggctatctggtggcgagtgattcggctctc
agtccgagcgaacgcctggaacgcatcaagcagcgcctgcgtgccgaattgccggaatac
atggtgccgctgcactggctgtggctggagcgcctgccgctcaacgccaacggcaagctc
gaccgcaaggccctgccggccctggagatcggccagttgcagagcaccgactacctggcg
ccgcgcagcgaactggagcagaccctggccgctatctgggccgaggtgctcaaggtcgag
caggtgggtgtgcacgacaacttcttcgagctgggcgggcattcgctgctggccacgcag
atcgcctcgcgggtgcagaaggccctgcaacgcaacgtgccgctgcgggcgatgttcgag
tgcagcacggtggaggaactggcgcactacatcgacggcctggcgaacagtgaaatcaac
gaggagaaggtcgatcggctgagcgatctgatggcggagctggaggggctctga

DBGET integrated database retrieval system