KEGG   Pseudomonas chlororaphis PCL1606: PCL1606_26780Help
Entry
PCL1606_26780     CDS       T03768                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pcz  Pseudomonas chlororaphis PCL1606
Brite
KEGG Orthology (KO) [BR:pcz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PCL1606_26780
Enzymes [BR:pcz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PCL1606_26780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like FAD_oxidored FAD_binding_3 DAO K_oxygenase AlaDh_PNT_C Thi4 FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AKA24129
UniProt: A0A0D5XZK5
LinkDB All DBs
Position
2878548..2880113
Genome map
AA seq 521 aa AA seqDB search
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSQEMLALLKDVASLSSLITLLDNGNDER
KPSFSINRPGADISLRFAGIPMGHEFTSLVLALLQVGGHPSKASVEVIEQIRALKGEFNF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQDEVNDRQIMAVPSIYLNGVNF
GQGRMGLEEILGKLDTGAAEKQAQAISAKDAFDVLVVGGGPAGASAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFVSVQETEGPKLAGALEAHVRQYDVDIMNLQRASALVPAKEAGG
LHEVRFESGATLKAKSLILATGARWREMGVPGEQEYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLLEFDSKLRADAVLQRKLHSLPNVDVITSALTSEVKGDG
QKVTGLVYKDRDSGEFNTVDLEGIFVQIGLLPNTDWLKGTVELSPRGEIIVDARGETSLP
GVFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagcccagttgaagtcatacctggaacgggtcacccagccg
atcgagatcgttgcctctctcgacgacggtgcgaaatcccaggaaatgcttgcgctgttg
aaagacgttgccagtctttccagcctgatcaccttgctcgacaacggtaacgatgagcgc
aagccatcgttctcgatcaatcgcccgggagccgatatcagcctgcgtttcgccggcatt
cccatgggccacgaattcacttcgctggtgctggccctgctgcaagtcggcggccacccg
tcgaaagccagtgtcgaagtgatcgaacagatccgcgccctcaagggcgagttcaacttc
gagacctacttctcgctgtcctgccagaactgcccggacgtggtccaggcgctgaacctg
atggcggtgctgaacccgaacatccggcatgtcgccatcgacggcgcgctgttccaggac
gaggtcaacgaccgccagatcatggccgttccgagcatctacctcaacggcgtgaatttt
ggtcagggccgcatgggcctggaggaaatcctcggcaagctcgacaccggcgcagccgag
aagcaggcgcaagccatcagcgccaaggacgccttcgatgtgctggtggtcggcggtggc
ccggcgggtgcttcggcagcgatctacgcggctcgcaagggcatccgtaccggtgtcgcg
gccgagcgcttcggcggccaggtgctggacaccatggcgatcgagaacttcgtttcggtc
caggaaaccgaagggccgaagctggccggtgccctggaagcccacgtgcgtcagtacgac
gtcgacatcatgaacctgcagcgcgccagcgcgctggtgccagccaaggaagccggcggc
ctgcatgaggtgcgtttcgaaagcggcgcgaccctcaaggccaagtcgctgatcctggct
accggcgcccgctggcgcgagatgggcgtgccaggcgagcaggaatacaaggccaagggc
gtgtgcttctgcccgcattgcgacggcccgctgtttaagggcaagcgcgtggcggtgatt
ggcggcggtaactccggcgtcgaggcggccatcgatctggcaggtatcgtcagccacgtg
accttgctggaattcgacagcaagctgcgcgccgatgcggtattgcaacgcaagctgcac
agcctgccgaacgtcgacgtcatcaccagcgcgctgaccagcgaagtgaagggtgacggc
cagaaggtcaccggcctggtgtacaaggaccgcgattcgggtgagttcaacacggtcgac
ctggaaggcatcttcgtgcagatcggcctgttgccgaacaccgactggctcaagggcacc
gtcgagctgtcgccccgtggcgagatcattgtcgatgcccgcggcgagacctcgctgcca
ggtgtgtttgccgccggtgacgtgaccaccgtgccgtacaagcagatcgtgatcgcggta
ggcgagggcgccaaggcttcgctcagtgccttcgaccacctgatccgcacttccgcgccg
gcctga

DBGET integrated database retrieval system