KEGG   Pseudomonas chlororaphis PCL1606: PCL1606_27110Help
Entry
PCL1606_27110     CDS       T03768                                 

Definition
(GenBank) 2,4'-dihydroxyacetophenone dioxygenase
  KO
K05913  2,4'-dihydroxyacetophenone dioxygenase [EC:1.13.11.41]
Organism
pcz  Pseudomonas chlororaphis PCL1606
Pathway
pcz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pcz00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00363 Bisphenol degradation
    PCL1606_27110
Enzymes [BR:pcz01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.41  2,4'-dihydroxyacetophenone dioxygenase
     PCL1606_27110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_7
Motif
Other DBs
NCBI-ProteinID: AKA24162
UniProt: A0A0D5XZK8
LinkDB All DBs
Position
complement(2914699..2915232)
Genome map
AA seq 177 aa AA seqDB search
MPEAARREFWKDLQPIANCFKPDAKPEVYLPDAATDDLKLYVPFTETVSSRPLWISPSEN
RWCDILMASSAGLVNRHYHPHEVFAYTLSGKWGYLEHDWTATAGDFVYETPGEGHTLVAY
EHEQPMRAFFIVKGPLIWLDEQGEPDGYFDVHSYIAMCRAHYEKIGFGAAYIDTLFR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagctgcccgccgtgaattctggaaagacctgcaaccgatcgccaactgcttc
aagccggacgccaagcccgaggtctacctgcccgatgccgccaccgacgacctgaagctg
tacgtgcccttcaccgaaaccgtgtcctcgcggccgctgtggatctcgccgagcgagaac
cgctggtgcgacatcctcatggccagcagcgccgggctggtgaaccggcattaccacccg
cacgaagtgttcgcctacaccctgtccggcaaatggggctacctggaacacgactggacc
gccaccgccggcgacttcgtctacgagacgccgggcgaaggccacaccctggtggcctac
gagcacgagcaaccgatgcgcgcgtttttcatcgtcaagggcccgctgatctggctcgac
gaacagggcgagccggacggctatttcgacgtgcattcctacatcgccatgtgccgcgcg
cactacgaaaagatcggcttcggcgcggcctacatcgacacgctgtttcgctga

DBGET integrated database retrieval system