KEGG   Pseudomonas chlororaphis PCL1606: PCL1606_27120Help
Entry
PCL1606_27120     CDS       T03768                                 

Definition
(GenBank) AraC family transcriptional regulator
Organism
pcz  Pseudomonas chlororaphis PCL1606
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 AraC_binding_2 HTH_AraC AraC_binding HTH_23 HTH_31
Motif
Other DBs
NCBI-ProteinID: AKA24163
UniProt: A0A0D5XYK8
LinkDB All DBs
Position
2915522..2916499
Genome map
AA seq 325 aa AA seqDB search
MSPCALLETRHACTQGMAPDQRLAFWEDYNASTLVGLKCTSFCESGFAASQDNLQLAGMR
LARIEGNEHVVERDNSMIRTVPKESVFVSFVTGSASFFYQDGACQLLEPGELIVYRTDKP
YLFGFSGPMRQFIFDIPQALFAERCLKRFDRPLKIGGQSGVQRLLSRTLGERTRGFFQQP
LSQDAEDYQNQAFELLRSLIAGQAGERRLNALSASYLLAAKQCISEQLADPGLSCERVAA
QTGVSVRHLSRLFALEDTQPSRFILEQRLQRAHDLLGSPRGRGLDIGEIAYRHGFASQAH
FARAFKAHYGLTPSEARASKAFTPA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtctccatgcgccttgctcgaaacccggcatgcctgcacccagggcatggccccggac
cagcggctggccttctgggaggactacaacgcgtccaccctggtcggcctcaaatgcacc
tccttttgtgaaagcggttttgccgccagccaggacaacctgcaactggcgggcatgcgc
ctggcgcggatcgagggcaacgaacacgtggtcgagcgcgacaactcgatgatccgcacg
gtgcccaaggagtcggtgttcgtgtccttcgtcaccggcagcgcctcgtttttctatcag
gatggcgcctgccagttgctcgaaccgggcgagctgatcgtctaccgcaccgacaaaccc
tacctgttcggcttctccgggccgatgcgccagttcattttcgatattccccaggcgctg
ttcgccgagcgctgcctgaagcgcttcgaccgccccctgaagatcggcgggcaaagcggc
gtgcagcgcctgttgtcgcgcaccctgggcgagcgcacgcgggggtttttccagcagccg
ttgagccaggacgccgaggattaccagaaccaggcgttcgagctgttgcgcagcctgatc
gccgggcaggcgggcgagcggcgcctcaatgccctgagcgcgtcctatctgctcgcggcc
aagcagtgcatcagcgaacagctggcggacccgggcctgagctgcgaacgggtggccgcg
caaaccggcgtctcggtacggcacctgagccgtctgttcgccctggaggacacccagccc
agtcgctttatcctggaacagcggctgcaacgggcccatgacctgctgggcagcccgcgg
ggccggggcctggacatcggcgaaatcgcctaccgccacggcttcgccagccaggcccac
ttcgcccgggcgttcaaggcccattacggcctgaccccgagcgaagcgcgcgcctccaag
gcgttcactcctgcgtag

DBGET integrated database retrieval system