KEGG   Pseudomonas chlororaphis PCL1606: PCL1606_43800Help
Entry
PCL1606_43800     CDS       T03768                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
pcz  Pseudomonas chlororaphis PCL1606
Pathway
pcz00020  Citrate cycle (TCA cycle)
pcz00190  Oxidative phosphorylation
pcz00650  Butanoate metabolism
pcz01100  Metabolic pathways
pcz01110  Biosynthesis of secondary metabolites
pcz01120  Microbial metabolism in diverse environments
pcz01130  Biosynthesis of antibiotics
pcz01200  Carbon metabolism
Module
pcz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pcz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pcz_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pcz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PCL1606_43800
   00650 Butanoate metabolism
    PCL1606_43800
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PCL1606_43800
Enzymes [BR:pcz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PCL1606_43800
    1.3.5.4  fumarate reductase (quinol)
     PCL1606_43800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4
Motif
Other DBs
NCBI-ProteinID: AKA25827
UniProt: A0A0D5Y499
LinkDB All DBs
Position
complement(4789146..4789859)
Genome map
AA seq 237 aa AA seqDB search
MIDMLQVEVYRYNPDTDAAPKTQVFQVDTGGKDLMVLDVLALIKEQDEGFSYRRSCREGV
CGSDGMNINGKNGLACITPLSSVVKNNKLVIRPLPGLPVIRDLVVDMSIFYKQYEKVKPF
LQNDTPAPAIERLQSPEERDKLDGLYECILCACCSTSCPSFWWNPDKFLGPAALLQAYRF
LADSRDTKTSERLASLDDPFSVFRCRGIMNCVNVCPKGLNPTKAIGHIRNMLLSSGV
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgatatgttgcaagttgaagtttatcgttacaaccctgacaccgacgctgcgccg
aaaacccaggttttccaggtcgacaccggtggcaaggatctgatggtgctggacgtgctg
gcgctgatcaaggagcaggacgagggtttctcctaccgtcgctcctgccgtgaaggcgtt
tgtggttccgatggcatgaacatcaacggcaagaacggcctggcttgcatcacgccgctg
tcctccgtggtgaagaacaacaagctggtcattcgtccgttgccaggtttgccggttatc
cgtgacctggtcgtcgatatgagcatcttctacaagcaatacgagaaggtgaagccattc
ctgcagaacgacacgccggccccggccatcgagcgtctgcagtcccctgaagagcgcgac
aagctcgatggtctgtacgagtgcatcctgtgcgcttgctgctcgacttcctgcccgtcc
ttctggtggaacccggacaagttcctgggcccggctgctctgctgcaagcctatcgcttc
ctggcagacagccgcgacaccaagacatccgagcgtctggcttcgctggatgatccgttc
agcgtattccgctgccgcggcatcatgaactgcgtcaacgtctgtccgaaaggcctgaac
ccgactaaggccatcggtcacatacgtaacatgctgctctcgagcggcgtgtga

DBGET integrated database retrieval system