KEGG   Pseudomonas chlororaphis PCL1606: PCL1606_43810Help
Entry
PCL1606_43810     CDS       T03768                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pcz  Pseudomonas chlororaphis PCL1606
Pathway
pcz00020  Citrate cycle (TCA cycle)
pcz00190  Oxidative phosphorylation
pcz00650  Butanoate metabolism
pcz01100  Metabolic pathways
pcz01110  Biosynthesis of secondary metabolites
pcz01120  Microbial metabolism in diverse environments
pcz01130  Biosynthesis of antibiotics
pcz01200  Carbon metabolism
Module
pcz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pcz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pcz_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pcz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PCL1606_43810
   00650 Butanoate metabolism
    PCL1606_43810
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PCL1606_43810
Enzymes [BR:pcz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PCL1606_43810
    1.3.5.4  fumarate reductase (quinol)
     PCL1606_43810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO GIDA HI0933_like FAD_binding_3 Thi4 Pyr_redox_3 FAD_oxidored DUF2087
Motif
Other DBs
NCBI-ProteinID: AKA25828
UniProt: A0A0D5Y3B1
LinkDB All DBs
Position
complement(4789863..4791635)
Genome map
AA seq 590 aa AA seqDB search
MANIPTISFDAIIIGGGGAGMRAALQLAQGGHKTAVITKVFPTRSHTVSAQGGITCAIAS
ADPNDDWRWHMYDTVKGSDYIGDQDAIEYMCQEGPAAVFELDHMGLPFSRTEQGRIYQRP
FGGQSKDYGKGGQAARTCAASDRTGHALLHTLYQGNLKAGTTFLNEYYAVDLVKNQDGAF
VGVIAICIETGETTYIRAKATVLATGGAGRIYASTTNALINTGDGVGMALRAGVPVQDIE
MWQFHPTGIAGAGVLVTEGCRGEGGYLINKHGERFMERYAPNAKDLAGRDVVARSMVKEI
IAGNGCGPNGDHVMLKLDHLGEEVLHSRLPGICELSKTFAHVDPVVAPVPVVPTCHYMMG
GVATNIHGQAITQNAEGVDEIIPGLFAVGEVACVSVHGANRLGGNSLLDLVVFGRAAGLH
LEKALTDGIEYDDATEADINAALARLNALNERTDGEDVATLRRELQSCMQNYFGVFRTGE
YMQKGIAQLAELRTRIANVKINDKSQAFNTARIEALELQNLLEVAEATAIAAEVRKESRG
AHAREDFEDRDDENWLCHTLYFPGEKRVAKRAVNFSPKTVPTFEPKVRTY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggctaacattccaacgatttctttcgacgccatcatcattggcggcggcggcgccggc
atgcgtgccgcactgcagctggcccagggcggccacaagactgcggtgatcaccaaggtg
ttcccgacccgttcgcacactgtgtcggcccagggcggcatcacctgcgccatcgcgtcg
gccgacccgaacgatgactggcgctggcacatgtacgataccgtcaagggttccgactac
atcggtgaccaggacgctatcgaatacatgtgtcaggaaggcccggccgcggttttcgag
ctggaccatatgggtctgccgttctcccgtaccgaacaaggccgtatctaccagcgtcct
ttcggcggtcagtccaaggattacggcaagggtggccaggctgcccgtacctgtgccgct
tccgaccgtaccggtcacgcgctgctgcacactctttatcagggcaacctgaaagccggc
accaccttcctgaacgagtactacgccgttgacctggtgaagaaccaggacggcgcgttc
gtcggtgtgatcgcgatctgcatcgaaaccggtgaaaccacctacatccgcgcgaaagcc
accgtgctggctaccggcggtgcaggtcgtatctacgcttccaccaccaatgccctgatc
aacaccggcgacggcgtcggcatggcgctgcgtgccggcgtaccggtacaagacattgaa
atgtggcagttccaccctaccggcatcgccggcgccggtgtactggttaccgaaggttgc
cgtggtgaaggtggttacctgatcaacaagcacggcgagcgtttcatggagcgttacgct
ccgaacgccaaggaccttgccggtcgtgacgttgttgcccgttcgatggtcaaggaaatc
atcgccggcaacggttgcggtcccaatggcgaccacgtgatgcttaagctcgaccacctg
ggcgaggaagtgctgcacagccgtctgccaggcatctgcgaactgtccaagacgttcgct
cacgttgacccggtggttgctccggttccggttgtaccgacttgccactatatgatgggc
ggcgttgctaccaacatccatggccaggcgatcacccagaacgccgaaggcgtggacgaa
atcattcctggtctgttcgccgtgggcgaagtggcttgcgtatcggtgcacggtgccaac
cgcctgggtggcaactcgttgctcgacctggtggtcttcggtcgcgctgccggcctgcac
ctggaaaaagccctgaccgacggtatcgaatatgacgacgctaccgaggccgacatcaac
gcggccctggcacgtctgaacgctctgaacgagcgtaccgatggcgaagacgtggcaacc
ctgcgtcgcgagctgcagagctgcatgcagaactacttcggtgtattccgtactggcgaa
tacatgcagaagggcattgcccagctggccgagctgcgtacccgcatcgccaacgtcaag
atcaacgacaagtcgcaggcgttcaacactgcgcgtatcgaagcgctggaactgcagaac
ctgctggaagtggccgaagccaccgccatcgctgccgaagtgcgcaaagagtcccgcggt
gctcatgcccgtgaagacttcgaagaccgcgacgacgaaaactggctgtgccacaccctg
tacttcccgggtgagaagcgcgttgccaagcgtgccgttaacttctcgccgaagactgtt
ccgactttcgagccaaaagtccggacttactaa

DBGET integrated database retrieval system