KEGG   Pseudomonas chlororaphis PCL1606: PCL1606_49560Help
Entry
PCL1606_49560     CDS       T03768                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pcz  Pseudomonas chlororaphis PCL1606
Pathway
pcz00620  Pyruvate metabolism
pcz00680  Methane metabolism
pcz01100  Metabolic pathways
pcz01120  Microbial metabolism in diverse environments
pcz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pcz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PCL1606_49560
  09102 Energy metabolism
   00680 Methane metabolism
    PCL1606_49560
Enzymes [BR:pcz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PCL1606_49560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKA26403
UniProt: A0A0D5Y502
LinkDB All DBs
Position
complement(5385541..5388171)
Genome map
AA seq 876 aa AA seqDB search
MTDIDARLREDVHLLGELLGNTIREQYGEGFLDKIEQIRKGAKADRRGSLDAELSASLNQ
LSEDELLPVARAFNQFLNLANIAEQYQLIHRREESQAAPFEARVLPELLARLRAEGHGAE
ALARQLGRLEIELVLTAHPTEVARRTLIQKYDAIAAQLAAQDHRDLTSAERGQIQARLQR
LIAEAWHTEEIRRTRPTPVDEAKWGFAVIEHSLWQAIPNYLRKADQALQAATGMRLPLEA
APIRFASWMGGDRDGNPNVTAAVTREVLLLARWMAADLYLRDVDQLAADLSMQQANAALR
ALAGDSAEPYRAVLKQLRERLRATRNWAQASLSGAAPAPAQVLQNNRELLDPLELCYQSL
HECGMGVIADGPLLDCLRRAVTFGLFLVRLDVRQDSSRHTAAMTEITDYLGLGRYGDWNE
EERIAFLMRELGSRRPLLPGYFKPSADTAEVLATCREIAAAPAASLGSYVISMAGAASDV
LAVQLLLKESGVLRPMRVVPLFETLADLDNAGPVIEQLLLLPGYRARLQGPQEVMIGYSD
SAKDAGTTAAAWAQYRAQERLVDICREQQVELLLFHGRGGTVGRGGGPAHAAILSQPPGS
VAGRFRTTEQGEMIRFKFGLPDIAEQNLNLYLAAVLEATLLPPPLPQPAWRDLMDELAAD
GVQAYRAVVRENPQFVEYFRQSTPEQELGRLPLGSRPAKRRAGGIESLRAIPWIFGWTQT
RLMLPAWLGWETALSKALERGEGELLGQMREQWPFFRTRIDMLEMVLAKADADIARSYDE
RLVEPALLPLGAHLRDLLSQACSVVLGLTGQSQLLAHSPDTLEFIRLRNTYLDPLHLLQA
ELLARSRRQDGTQDSPVEQALLVSVAGIAAGLRNTG
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatattgatgcgcgcttgcgcgaagatgttcacctgctgggtgaactgttgggc
aacaccatccgtgaacagtatggcgagggtttcctcgacaagatcgaacagatccgcaag
ggcgccaaggccgaccggcgcggttcgctggacgccgagctcagcgccagcctcaaccag
ctcagcgaggatgaactgctgccggtggcgcgggcgttcaaccagttcctcaacctggcc
aacatcgccgagcaataccagctgatccaccgccgcgaagagtcgcaggcggccccgttc
gaggcgcgggtgctgccggaactgttggcgcgcctgcgggccgaaggccatggcgcagag
gccctggcccggcaactggggaggctggagatcgagttggtgctgaccgctcaccccacg
gaagtcgcccgccgcacactgatccagaaatacgacgccatcgccgcgcaactggccgcc
caggatcatcgcgacctgacgtcggccgagcgtgggcagatccaggcgcgcttgcaacgg
ctgatcgccgaagcctggcacaccgaggaaatccgccgcacccgcccgaccccggtggac
gaagccaagtgggggttcgcggtgatcgaacactcgctgtggcaggccatccccaactac
ctgcgcaaggccgaccaggccttgcaggcggccaccggcatgcgcctgcccctggaagcg
gcgccgatccgcttcgcctcgtggatgggcggcgaccgcgacggcaaccccaacgtcacc
gcggccgtgacccgcgaggtgctgttgctggcgcgctggatggcggccgatttgtacctg
cgcgatgtcgaccagctggcggccgatctttccatgcagcaagccaacgcagcgctgcgg
gccctggccggcgacagcgccgagccctatcgcgcggtgctcaagcaactgcgcgagcgc
ctgcgggccacccgcaactgggcccaggcctcgttgagcggcgccgcgccggcgcccgcg
caggtcctgcagaacaaccgcgaactgctggacccgctggagctctgctatcagtccctg
catgaatgcggcatgggcgtgatcgccgacgggccgctgctcgattgcctgcgccgggcg
gtgaccttcggcctgttcctggtgcgcctggacgtgcgccaggactcctcgcgacatacc
gcggcgatgaccgaaatcaccgactacctgggcctgggccgttacggcgactggaacgag
gaggagcgcatcgccttcctgatgcgcgaactgggcagtcgtcgtccgctgctgcccggg
tacttcaagccctcggccgataccgccgaggtgctggcgacctgccgggagatcgccgcg
gcgccggcggcttcgctggggtcctatgtgatctccatggccggcgcggcttccgatgtg
ctcgccgtgcagttgctgctcaaggagtctggcgtgctgcggccgatgcgcgtggtgccg
ttgttcgagaccctggccgacctcgacaacgccggcccggtgatcgagcaactgctgctc
ctgccgggttatcgcgcacgcttgcagggcccgcaggaagtgatgatcggttactccgat
tcggccaaggacgccggcaccaccgcagccgcctgggcgcagtaccgggcccaggagcgg
ctggtggatatctgccgcgagcagcaggtcgagctgctgttgttccacggtcgcggcggc
accgtggggcgcggcggcggtccggcccacgcggcgatcctgtcgcagccgccgggctcg
gtggcggggcgcttccgcaccaccgaacagggggagatgattcgtttcaaattcggcctg
ccggacatcgccgaacagaacctcaacctctacctggccgcggtactggaagccaccctg
ttgccgccgcccttgccgcagccggcctggcgcgacctgatggacgagctggccgccgac
ggggtgcaggcctatcgcgcggtcgtgcgggaaaacccccagttcgtcgagtatttccgc
cagtccacgccggagcaggaactgggtcgcctgccgctgggcagccggccggccaagcgc
cgtgccggtggcatcgaaagcctgcgggccatcccgtggattttcggctggacccagacg
cgcctgatgttgccggcctggctgggctgggagaccgccttgagcaaggccctggagcgc
ggggagggcgagttgctggggcagatgcgcgagcagtggccatttttccgcacccgcatc
gacatgctggagatggtgctggccaaggccgacgcggacatcgcccgctcctacgacgag
cgcctggtcgaaccggcgctgctgccattgggtgcgcacttacgcgacttattgtcgcag
gcgtgttcggtggtgctggggctgaccgggcagtcgcagttgctggcacatagcccagac
accctggagttcatccgcctgcgcaacacctacctggatccgctgcatctattgcaggcc
gaactgctggcccgttcgcgacgccaggacggcacgcaggacagcccggtggaacaggcg
ctgctggtgtctgtggcgggcatcgccgccggcctgcgtaacaccggctga

DBGET integrated database retrieval system