KEGG   Phoenix dactylifera (date palm): 103696900Help
Entry
103696900         CDS       T03274                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 4-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00061  Fatty acid biosynthesis
pda00071  Fatty acid degradation
pda01100  Metabolic pathways
pda01212  Fatty acid metabolism
pda04146  Peroxisome
Module
pda_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    103696900
   00071 Fatty acid degradation
    103696900
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103696900
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pda01004]
    103696900
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pda04147]
    103696900
Enzymes [BR:pda01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     103696900
Lipid biosynthesis proteins [BR:pda01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   103696900
Exosome [BR:pda04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   103696900
  Exosomal proteins of breast cancer cells
   103696900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-GeneID: 103696900
NCBI-ProteinID: XP_026656856
UniProt: A0A3Q0HQG4
LinkDB All DBs
Position
Unknown
AA seq 695 aa AA seqDB search
MRHLIEVEKGREAADGRPSVGPTYRSAFAKDGFPPPVPGVESCWDVFRMSVERCPNNRML
GRREIVDGKPGKYVWMTYKEVYDVVMKIGASIRTLGVEQGGRCGIYGSNCPEWVISMEAC
NAHGIYCVPLYDTLGAGAVEFILCHSEVQIAFAEEKKIGEVSKTLPSSSKFLKAIVSFGK
VTSEQRDEVEKSGLAIYSWDEFLLLGSNQQYDLPLKKKTDTCTIMYTSGTTGDPKGVMIS
NDSIITLIAGVDQLLYCVNVQLHEGDVYLSYLPLAHIFDRVIEELFIFHGASIGFWRGDV
KLLVEDIGELKPTIFCAVPRVLDHIYTGLQSKISSGGLLKSTLFNIAYKYKFRNMSKGSK
HEDAAAIFDKLVFNKVKGGLGGRVRIILSGAAPLATHVEEFLRVVTCSHVLQGYGLTETC
AGTFVTLPNNLAMLGTVGPPVPNVDVRLESVPEMNYDALAEVPCGEICVRGNTLFSGYYK
CEDLTKEVMIDGWFHTGDIGEWQPDGSMKIIDRKKNIFKLSQGEYVAVENLENVYGLVPD
LDSDRRDQWNDAPYVTAQIDTLSVGTVMRAWSWNIVYALLQEGIWIYGNSFESFLVAIVN
PNKQALEHWAEENGVRGDFAAICENPKAKEYILGELTKVAKQKKLKGFEFIKAIHLDPEP
FDMERDLLTPTYKKKRPQLRKYYQSVIDNLYKSAK
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgaggcatcttatagaggtggagaaggggagggaggctgccgacggccggccctccgtc
ggaccgacctaccggagcgcctttgccaaggacggctttcccccgcccgtccccggcgtc
gagagttgctgggatgtattccgtatgagtgtggagagatgccccaacaaccgaatgctg
ggccgtcgtgaaattgttgatggaaagccgggtaaatatgtctggatgacctacaaagaa
gtatatgacgtcgtgatgaagataggggcttcgatacggactcttggggtcgagcagggt
ggacgttgtggcatctatggttctaactgtcctgaatgggtcattagtatggaggcttgc
aatgctcatgggatttactgtgttcccttatatgatactcttggtgctggtgcagtagaa
ttcattttatgtcattcagaggttcagattgcttttgcagaagagaaaaagattggagag
gtgtcaaaaacccttcctagctcatctaaattcttaaaagcaattgttagttttggcaag
gtcacctctgagcaaagagatgaggttgaaaagtctggtttggcaatatattcatgggat
gaatttttgctcttgggaagtaatcaacaatatgatcttccattgaagaagaaaactgat
acatgtactataatgtacaccagtggaacaactggtgaccctaaaggtgtgatgatttcg
aatgatagcattatcactcttattgctggtgttgatcagctgctttattgtgtgaatgtg
cagttgcatgaaggtgatgtttatttatcttatctacccctcgctcatatctttgaccgt
gttattgaagagttgttcatttttcatggggcctcaattggattttggcgtggggatgtc
aagttgttagttgaagacattggggaattaaagccaactatcttttgtgctgttccacgt
gtgttggatcacatctatacaggactgcaatcaaagatttcatcaggaggtctcctgaag
agtacattgtttaatattgcttacaaatacaaatttcgtaacatgtcaaaaggaagtaag
catgaggatgcagctgcaatttttgataaattagtttttaataaggtaaaaggtgggctt
ggcgggagagtgcggataattctatctggagcagctcctctagcaacccatgtggaagaa
tttttacgggtggtgacgtgttcccatgttctacaaggctacggtcttacagagacttgt
gctggaacatttgtcactttgccgaataatctagcaatgcttggaacagtaggccctcca
gtaccaaatgttgatgtgcgcctggagtctgttcctgaaatgaactatgatgctcttgca
gaagttccttgtggagaaatctgcgtgagaggaaatactttattctcaggatactacaaa
tgtgaagatcttacaaaggaggttatgattgatggttggtttcacacaggggatattggt
gagtggcagcctgatggaagtatgaaaatcattgatcgaaagaaaaacatctttaagctt
tcacaaggagaatatgttgcagttgaaaatctggagaatgtctatggtctggttcctgat
ttagattcggatagaagagatcaatggaacgatgctccttatgttacagctcagattgat
acactatcagttggcacagtaatgagagcctggtcctggaacattgtttatgcacttctc
caagaagggatatggatatatggaaatagctttgagtctttccttgttgccattgtaaat
cccaataagcaagcccttgagcattgggctgaagaaaatggtgtaaggggggattttgct
gcaatatgtgagaaccccaaggcaaaagaatacattttgggggagcttacaaaggttgca
aaacaaaagaagctgaaaggttttgagttcataaaggcaattcaccttgatcctgaacca
tttgatatggagcgtgatctccttaccccaacatacaaaaagaagaggccacagctgcgc
aagtattaccagagtgtcatcgacaacctatacaaaagcgcaaagtaa

DBGET integrated database retrieval system