KEGG   Phoenix dactylifera (date palm): 103697882Help
Entry
103697882         CDS       T03274                                 

Definition
(RefSeq) probable alpha-glucosidase Os06g0675700
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00052  Galactose metabolism
pda00500  Starch and sucrose metabolism
pda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103697882
   00500 Starch and sucrose metabolism
    103697882
Enzymes [BR:pda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103697882
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 103697882
NCBI-ProteinID: XP_008778047
UniProt: A0A2H3X455
LinkDB All DBs
Position
Un
AA seq 924 aa AA seqDB search
MVLGQEIELHLRWWCFSQSRKRIVRGMGALSTDNFPLFFFYFFISFCFCSPSHSQQEPAA
GSGYKLQSINVNPSGKSLIAKLQLIQKSSIYGPDVQNLNLFASFETKDRLRVRITDSDRQ
RWEIPPSIIPRKPNLSYRAMPEGNPLKAYQSQPESHVLSFGGSDLLFTLHATTPFTFTIT
RRSTGDILFDTSPIIVFKDRYLEISSSLPAGRSSLYGLGEHTKKTFRLVPNDTLTMWNSD
IAAANTDVNLYGSHPFYVDVRSSSSSSSSNITHPPGVTHGVLLFNSNGMDVIYGGSYITY
KVIGGILDFYFFAGPLPLSVMDQYTELIGRPAPMPYWSFGFHQCRYGYKNVSDLEGVVAG
YARAKIPLEVMWTDIDHMDGFKDFTLDPINFPADKMKAFVEQLHQNGQKYVVILDPGISV
NNTYDTFLRGMKDGIFLKRDGDYYLGKVWPGPVYFPDFLNPAAAEFWAREIDIFRKTLPV
DGLWIDMNEISNFITSPPLNSLDDPPYKINNDGVRRPINNLTVPASALHYGNLSEYDVHN
LYGFLEAKATHDGLMKSTGKRPFVLSRSSFVGSGKYTAHWTGDNAAKWEDLGYSISSILN
SGLFGIPMVGADICGFGGDTTEELCGRWIQLGAFYPFARDHSSIDSNRRELYLWDSVARS
ARKALGLRYRLLPYFYTLMYEAHVKGAPIARPLFFSFPEDVKTYDISMQFLIGKGVMVSP
VLKQGVVSVDAYFPKGKWFNLFNHSQTVSSDSGKYVTLDAPEDTTNVHVRGGNILVMQEE
AMTLQLARQSGFELLVVLDEDNNATGEVYLDDGEVVEMASEENQWSLVRFSSVIEDKDVK
VRSEVVNGAYALNQKLILEKVVFLGLELKETPKMATIFVNGMEVSSNSEVSARYQMNGRL
GVAEIEGLSQLIGEEFELKFKLTN
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atggtcttggggcaggaaatagagctacacttgcggtggtggtgtttctcacaaagccga
aagaggattgtgagagggatgggagccttatccacagataatttcccccttttcttcttc
tacttcttcatctctttttgtttctgttctccatcccattctcagcaagaaccagctgct
gggtctggctacaagctccaatcgatcaatgtcaacccttcagggaagtcactgattgcg
aagcttcagcttattcagaagtcgtcgatctatggaccagatgttcagaacctcaatctc
ttcgcatcctttgaaaccaaagatcgcctgcgagtccgaataaccgattccgatcgccaa
agatgggaaattccaccgagcatcatcccacgcaagccaaatctctcctatcgagcaatg
cccgaaggcaatccattgaaagcctatcagtctcaaccggaaagccatgttctctccttc
ggaggctccgacctcctctttaccctccatgcaacaactcccttcaccttcaccatcacc
cgccgctccactggcgacatcctctttgacacttcgcccataattgtcttcaaagaccga
tacttagagatctcatcatcactccctgcagggagatcatccctctatggtctcggggag
cataccaagaagacattccggctggtccccaacgacacgttgacgatgtggaattccgac
atagctgcagcaaacacagatgtaaatctgtatggatctcacccattctacgttgatgtg
agatcatcatcatcatcatcatcatccaatatcacacacccgccaggagtgactcatggc
gtgctccttttcaacagcaatggcatggatgtcatctatggtggatcttacattacttac
aaagtgattggaggaattctcgacttctatttcttcgcaggtccattacctctatcagtc
atggatcagtacactgagctcattggccggccagcaccaatgccgtattggtcctttgga
ttccatcagtgtcgttatggctacaagaatgtatccgatctcgaaggcgtcgtagcagga
tatgccagggctaagatccctctcgaagtaatgtggacggacattgatcacatggatgga
ttcaaggacttcacacttgatcctatcaactttcctgcagacaagatgaaggcatttgtc
gaacagctgcaccagaatggacagaagtatgtggtcatactggacccaggtatcagtgtg
aataatacatatgatacattcctgagaggaatgaaagatggcatctttctgaagagagat
ggagactattaccttggaaaagtgtggcctggacctgtctacttccctgactttctgaac
ccagctgctgctgaattctgggccagagagatcgatatattccgcaagactcttccagtc
gatggcttatggattgacatgaatgagatctccaacttcatcacctccccgccgctcaat
tccctggatgaccctccttacaagatcaacaacgatggtgttcgaagacctatcaacaat
ttaacagttccagcctctgctcttcactatgggaacctatcagagtatgatgtgcacaac
ctctatggattcttggaagccaaggcaacccatgatggactgatgaagtccacagggaaa
aggccatttgtacttagtcgatcgagctttgttggctcagggaagtatacagctcattgg
accggtgataatgcagccaagtgggaggatctcggctactcaatttcatccatactgaac
tctggactgtttggtattccaatggtaggagcagacatctgcgggtttggcggagacacg
accgaggagctctgtggaagatggattcagcttggtgcattctatccctttgcgagggac
cactccagcatagacagcaaccgacgggagctctatctttgggactccgtcgcccgatcg
gcgaggaaggcactcggcctccgataccgcctacttccctacttctacacgctgatgtat
gaggcacatgtcaaaggtgcaccaattgcacgacccctcttcttctcattccctgaagat
gtcaagacctatgatatcagcatgcagtttctgatcggaaaaggtgtgatggtctcccca
gtattgaaacaaggagttgtctcagtcgacgcttattttccgaagggaaaatggttcaac
ctcttcaaccactcgcagacagtgagtagtgattctgggaagtatgtcacgctcgatgca
ccagaggatactacaaacgtgcatgtgagaggaggaaacatcttggtaatgcaggaagag
gcaatgacactgcaactggcacggcagagtggattcgagctcctggtggtgctcgacgag
gataacaatgcaactggggaggtctatttggatgatggagaggtggtggagatggcaagt
gaggagaatcaatggagtttagtgaggttcagcagtgtgatagaagataaggatgtgaag
gtcaggtcagaggttgtgaatggtgcatatgctttgaatcagaaattgatactagagaag
gttgtgttcctggggttggagttgaaagaaacacctaaaatggctaccatatttgtgaac
ggaatggaagtaagtagtaattcagaggtaagtgctaggtaccaaatgaatgggaggctt
ggagtcgcagagattgaaggcttgtcgcagctcattggtgaggaatttgagttgaaattc
aagctcacaaattaa

DBGET integrated database retrieval system