KEGG   Phoenix dactylifera (date palm): 103701146Help
Entry
103701146         CDS       T03274                                 

Definition
(RefSeq) glutathione transferase GST 23-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103701146
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pda02000]
    103701146
Enzymes [BR:pda01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103701146
Transporters [BR:pda02000]
 Other Transporters
  Pores ion channels [TC:1]
   103701146
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_N_4 GST_C_3
Motif
Other DBs
NCBI-GeneID: 103701146
NCBI-ProteinID: XP_008781341
UniProt: A0A2H3XBK1
LinkDB All DBs
Position
Unknown
AA seq 231 aa AA seqDB search
MASGGGEVKLFGMWASPAVRRVEWALKMKGIEYEYIEEDLSNKSASLLAYNPINKQVPVL
LHNGKPIAESLVIIEYIDEVWKHNPILPEDPYERTKARFWSTYSEGKCRDAVGKGYFTEG
EEKENAIKYLEETVRVLDEELKGKKFFGGENLGFSDLVLGWMAFWLPVAEEVAFFEVLDS
KKFPWFASWTDNFLEVPVIKENLPPRDKTVEFFENYRRQRLGASKCIKTHA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcggcggcggcgaggtgaagctcttcggaatgtgggcaagtcctgcagttcgt
cgagtcgagtgggctttgaagatgaaggggatcgagtacgagtacatagaagaagatctc
tcgaacaagagcgcatctcttctcgcgtacaatccgatcaataagcaagtccccgtgctc
ctccacaacggcaagccgatcgccgaatcccttgttatcattgaatatattgatgaggtc
tggaagcataaccccatcttacctgaggatccttatgaacgaaccaaggcacgcttttgg
agcacatatagtgagggcaagtgtcgagatgcagtagggaaagggtactttacggaagga
gaggagaaagagaatgctatcaaatatttggaggaaactgtgagagtactggatgaagag
ctgaagggaaagaagttctttggaggagaaaaccttggattctcggacttggttttgggc
tggatggctttctggttaccggtggcagaggaggttgccttctttgaggtgttggattct
aagaagtttccgtggtttgcttcatggactgataattttctcgaagttcctgtgatcaaa
gagaaccttccaccccgcgacaagacggtggagttcttcgagaactatcgccggcaacgg
ttaggtgcatcaaaatgcatcaaaacccatgcatga

DBGET integrated database retrieval system