KEGG   Phoenix dactylifera (date palm): 103701633Help
Entry
103701633         CDS       T03274                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00010  Glycolysis / Gluconeogenesis
pda00053  Ascorbate and aldarate metabolism
pda00071  Fatty acid degradation
pda00280  Valine, leucine and isoleucine degradation
pda00310  Lysine degradation
pda00330  Arginine and proline metabolism
pda00340  Histidine metabolism
pda00380  Tryptophan metabolism
pda00410  beta-Alanine metabolism
pda00561  Glycerolipid metabolism
pda00620  Pyruvate metabolism
pda00903  Limonene and pinene degradation
pda01100  Metabolic pathways
pda01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103701633
   00053 Ascorbate and aldarate metabolism
    103701633
   00620 Pyruvate metabolism
    103701633
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103701633
   00561 Glycerolipid metabolism
    103701633
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103701633
   00310 Lysine degradation
    103701633
   00330 Arginine and proline metabolism
    103701633
   00340 Histidine metabolism
    103701633
   00380 Tryptophan metabolism
    103701633
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103701633
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    103701633
Enzymes [BR:pda01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103701633
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh BMC
Motif
Other DBs
NCBI-GeneID: 103701633
NCBI-ProteinID: XP_008781996
UniProt: A0A2H3XDA3
LinkDB All DBs
Position
Unknown
AA seq 543 aa AA seqDB search
MAAARRLASSLLSRSLSASSPRSLTSLFRGDGTRASEFGVLHRFSTAVAVEEPITPPVQV
QYTQLLINGQFVDAASGRTFPTLDPRTGEVIAHVAEGDVEDVNRAVAAARKAFDQGPWPR
MTGYERSRILLRFADLIEKHNDEIAALETWDNGKPYEQAANVEIPMFARLMRYYAGWADK
IHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMYAWKVGPALACGNTIVLKAAEQTP
LSALYVSKLLHEAGLPEGAINVIPGFGPTAGAALASHMEVDKLAFTGSTDTGKIVLELAA
RSNLKPVTLELGGKSPMIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHEKVYDEF
VEKAKARALKRVVGDPFRKGVEQGPQIDEDQFNKILRYIKSGIDSGATLQAGGDRLGSKG
YFIQPTIFSDVKDGMQIAQEEIFGPVQSILKFSDLNEVIRRANTTRYGLAAGVFTNNLDT
ANTLTRALRAGTVWINCFDVFDAAIPFGGYKMSGQGREKGIDSLKNYLQVKAVVTPLKNP
AWL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgcgcgaagacttgcgtcctccctcctttcgcgatctctctccgcttcttct
cctcgttctctcacctccctgtttcgcggagatggaacacgtgcctccgaatttggggtt
cttcataggtttagcaccgcagttgccgttgaagaaccgatcacgccaccagttcaagta
caatacacacagcttctgatcaatgggcaatttgtggatgcggcatcaggtaggacattt
ccaacattagatcctaggactggggaagtgattgcccatgttgctgaaggagatgtcgaa
gatgtcaaccgtgccgttgctgctgcccgcaaagcatttgatcaaggaccgtggcctagg
atgactggctacgaaaggtcacgcatacttctgcggttcgcggatttgattgagaaacat
aatgatgagattgcagcacttgagacttgggataacgggaagccttatgaacaggctgcc
aatgtagaaattccaatgttcgctcgtctaatgagatattatgctggttgggcagacaag
atacatggacttgttgtgccagctgatggtccgcatcatgtgcaagtcctgcatgagcca
attggtgttgcagggcagattatcccatggaactttccacttcttatgtatgcttggaag
gttggcccagcactagcatgtgggaacaccatagtattgaaggctgcagagcaaactcct
ctatctgctctttacgtctccaaactgttgcatgaggctgggcttcccgagggtgctata
aatgtaatccctggatttggtccaactgctggtgcagctcttgcgagtcacatggaagtt
gacaagcttgcttttaccggatcaactgatactggcaagatcgtacttgaattggctgca
agaagcaatcttaagccagtgacattagagcttggaggcaagtcccctatgatcataatg
gatgatgccgatgtggaccatgcagtggaacttgcacattttgctttgttctttaatcag
ggacagtgctgctgtgctgggtctcgtacatttgtgcatgaaaaggtgtatgatgagttt
gtggagaaagcaaaagctcgtgctttgaagcgtgttgttggtgaccccttcagaaagggt
gttgaacaaggtcctcagatagatgaggatcagttcaacaagatcctgcgctacatcaaa
tctggcattgacagtggggccactcttcaagcaggaggcgacagattaggcagcaagggt
tacttcattcagcctaccatcttctcagatgtgaaggatggaatgcaaatagcacaagag
gagatctttgggcctgttcaatccatcttaaaattcagtgatcttaatgaggtgatacgg
agggcaaacaccactcgttacgggctggctgctggagttttcaccaacaacttggacact
gccaacaccttgacgcgtgccctgagagctggaacagtatggatcaattgctttgatgtc
ttcgatgctgcgattccttttggtggctacaagatgagtgggcaaggaagagaaaagggc
atcgatagcctcaaaaactacctacaggttaaggcagttgtgactccattgaagaaccct
gcatggttgtga

DBGET integrated database retrieval system