KEGG   Phoenix dactylifera (date palm): 103702042Help
Entry
103702042         CDS       T03274                                 

Definition
(RefSeq) ent-kaurene oxidase 2-like
  KO
K04122  ent-kaurene oxidase [EC:1.14.14.86]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00904  Diterpenoid biosynthesis
pda01100  Metabolic pathways
pda01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    103702042
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pda00199]
    103702042
Enzymes [BR:pda01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.86  ent-kaurene monooxygenase
     103702042
Cytochrome P450 [BR:pda00199]
 Cytochrome P450, plant type
  CYP701 family
   103702042
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 DUF3463
Motif
Other DBs
NCBI-GeneID: 103702042
NCBI-ProteinID: XP_008782548
UniProt: A0A2H3XEP7
LinkDB All DBs
Position
Unknown
AA seq 559 aa AA seqDB search
MGNPQVQLASPFRNLPIIRSPAHGNSPLELLRAQGRARGSPSTSMDAVLVTLRNTPVGVV
TSLALGLLTVAIIVGKLRVGRSRRLNRPPAVPGLPLIGNLHQLKDKKPHQTFAKWAEIYG
PIYSIRTGASTVVVLNSAAVAKEALVTRFNSLSTRKLSNALTLLTSNKSMVATSDYGEFH
KMVKRYILTSVLGSNAQKQYRGLRDSMINNVVNILHSEIKDNPQSAVNLREPFEVELFRL
SLKEALGKDVESVYVEELGQEMSKKEIFDVLVMDPMMGAIEVDWRDFFPYLRWVPNRSME
MKIQRMVTRKRAVTRALINEQKKRIALGEEINCYLDFLLSENNLTEEQLITLIWEAIIES
SDTTLVTTEWAMYELAKNPKCQDRLYHEIREVCGSEMVMEEHLPQLPYLNAVFHETLRKY
SPAPIVPLRYAHEDTQLGGYDIPAGTQIAINLYACNMDKKDWDEPEEWKPERFLSSNFEP
MDLHKTMAFGGGKRVCAGSLQAMLISCTAIGRLVQEFDWRLKEGEEDNMDTVKLTTHKLQ
PMHAYIAARAMDHSGLQSS
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatccgcaggtccagctggcatcgccattccgtaaccttcctataatacgaagt
cctgcccatggaaactcaccattggaacttttgagagcacaagggcgagcgagagggtca
ccttcaacatcaatggatgccgttctggtgactctgcggaacactccagttggggttgtt
acgtccctcgctctcggcctccttaccgttgccatcatcgtcgggaagcttcgcgtcggt
cggagccggcgcttaaaccgtccccccgctgttcctgggctgcctttgattgggaatctg
catcagctcaaggacaagaaaccccaccagaccttcgcgaaatgggcagaaatttatggg
cctatctactccatcagaacaggagcttctacagtggtcgtcctcaattcagctgcagtg
gccaaggaggcattggtgactagattcaactctctctcgactcgaaagctttcaaatgcg
ctgacattgctcacttccaacaaatctatggttgccacgagtgactacggcgagttccat
aaaatggtgaagcgctacatcctcacgagtgttttgggatcaaatgctcagaagcaatat
cgtggcctcagggacagcatgatcaataacgtcgtaaacattctgcattcagagataaag
gacaatcctcaaagtgcagtcaacctcagggagccatttgaggtggagcttttccgatta
tccttgaaagaagctctgggcaaggatgtagaatctgtttacgtggaggaacttgggcaa
gagatgtcaaagaaagaaatttttgatgtcctagtcatggatccaatgatgggtgcaata
gaggtagactggagggatttcttcccgtatctgagatgggttcctaataggagcatggaa
atgaaaattcaaagaatggtgactcgtaagagagcggtgacaagggccttgatcaatgaa
cagaagaaacgcattgcacttggagaggaaataaactgctatctggactttctactgtct
gaaaacaatctgacagaggagcagttgatcacgttgatttgggaagcgataattgagtcc
tctgacacaactttggtcacaacagaatgggctatgtatgaacttgctaagaatccaaag
tgtcaggatcgcctttatcatgaaatccgagaagtatgtgggtctgaaatggttatggag
gagcacttgccacagctaccatacctgaatgctgttttccatgaaactctaaggaagtat
tctcctgctcctattgttccccttagatatgcccatgaagacacccaactaggagggtat
gacattccggctgggacacagattgccatcaatctttatgcatgtaatatggacaagaag
gactgggatgaacctgaagaatggaagcctgagagatttctgtctagcaatttcgaacca
atggatcttcacaagacgatggcttttggaggaggaaaaagagtatgtgctggatctttg
caggcaatgctaatttcttgtacggccattggtagactcgtgcaagagtttgattggaga
ctgaaagaaggagaggaagataacatggatactgttaagctcacaacccacaaacttcag
cctatgcatgcatacattgccgccagagcaatggatcattcaggattgcagtcatcctaa

DBGET integrated database retrieval system