KEGG   Phoenix dactylifera (date palm): 103702714Help
Entry
103702714         CDS       T03274                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial isoform X1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00020  Citrate cycle (TCA cycle)
pda00190  Oxidative phosphorylation
pda01100  Metabolic pathways
pda01110  Biosynthesis of secondary metabolites
pda01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103702714
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103702714
Enzymes [BR:pda01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103702714
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-GeneID: 103702714
NCBI-ProteinID: XP_008783478
UniProt: A0A2H3XGL0
LinkDB All DBs
Position
Unknown
AA seq 634 aa AA seqDB search
MWQSCVSRGLRLLSSKKASIGRQPIRHSPSTPRFLVTNSVGQYTVVDHTYDAVVVGAGGA
GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW
LGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLNFGKGGQAYRCACA
ADRTGHALLHSLYGQAMKHNTQFFVEYFALDLLMDSNGTCQGVIALNMEDGTLHRFHAAN
TILATGGYGRAYFSATSAHMCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGS
RGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHL
PPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVHIKGDDPDC
IVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEICKPGEKQKPLEKYAGE
RTIAWLDKLRNSNGSLSTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHDVK
IRDRSLIWNSDLIETVELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWLKHSL
GYWENEKVTLAYRPVHMNTLDDEVESFPPKARVY
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagagctgcgtgtcccgaggccttcgcctcctctcctccaagaaggcgtcgatc
ggacgccagccgatccgccactccccgtctacgcccagatttcttgtcaccaactcggtt
ggacagtacactgttgtggatcacacctatgatgcagttgtcgtaggagctgggggtgct
ggacttagagctgccattggactctctgagcatggctttaacacagcttgcattaccaag
ctcttccctactcgctctcatacagttgcagctcagggtggtataaatgcagcccttgga
aatatgaccgaagatgactggaggtggcatatgtatgatacagtcaaaggaagtgattgg
ttaggtgatcaggatgctattcaatatatgtgcagagaagcaccaaaagcagttattgag
cttgaaaattatggattaccattttcccgaactgaagatgggaagatctatcaacgtgct
tttggaggtcaaagtttgaactttgggaaaggtggccaagcctatcggtgtgcgtgcgct
gctgatcgaactggtcatgcattgcttcactcgctttatggtcaagcaatgaagcataac
acccagttctttgtggaatactttgcattggatcttctcatggatagcaatgggacttgc
cagggggtgattgcactgaacatggaggatgggacccttcaccgtttccatgctgccaac
acaattttggcaactgggggttatggcagagcatacttttctgcaacctcagctcatatg
tgtacaggagatggcaatgctatggttgcacgtgctggattgcctctccaggatcttgag
tttgttcagttccaccctactggcatatatggtgctgggtgcctcatcactgaaggatct
cgtggtgaaggtggtatccttagaaacagtgaaggcgaacgttttatggaacgatatgct
cctactgccaaggatcttgcatcacgagatgttgtttcaagatcaatgacaatggaaata
agagaaggtcgtggtgtaggaccactgaaggatcacatctatctgcatttgaatcattta
ccaccggatgttctcaaggaaagacttcctggcatatctgaaacagctgctatttttgct
ggtgtggatgtcactaaggagcccatccctgttttgcctacagtgcactataatatgggt
ggaatccccacaaactatcatggggaggtagttcatatcaaaggtgatgatccagattgc
atagttcctggtctgatggctgctggagaggcagcttgtgcatctgttcatggtgcaaat
cgacttggtgcaaattcccttcttgatatagtggttttcggcagagcttgtgctaacagg
gttgcagagatttgcaagccaggagagaaacagaaacctcttgaaaaatatgctggagaa
aggaccattgcctggcttgataaattaagaaactcaaatggttcactgtcaacttcaaaa
attcgtctcaacatgcaacgggtaatgcaaaacaatgctgctgtttttcgaactcaagaa
acactagaagaaggttgtcagttaattgacaaagcttgggagagttttcatgatgtcaaa
attcgtgatcggagtttgatatggaattctgacttaatagaaacagtagagctggaaaat
cttctaataaatgcatgtataactatgcactcagctgaggcaaggaaggagagtagagga
gctcatgctcgtgaagattttacgaaaagagacgatgagaactggttgaaacattcacta
ggatactgggagaatgagaaggtcacactggcatataggcccgtccacatgaataccctg
gatgatgaagttgagtcattcccaccaaaagcacgtgtttactaa

DBGET integrated database retrieval system