KEGG   Phoenix dactylifera (date palm): 103705614Help
Entry
103705614         CDS       T03274                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: DNA ligase 6-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda03030  DNA replication
pda03410  Base excision repair
pda03420  Nucleotide excision repair
pda03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pda00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    103705614
   03410 Base excision repair
    103705614
   03420 Nucleotide excision repair
    103705614
   03430 Mismatch repair
    103705614
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pda03032]
    103705614
   03400 DNA repair and recombination proteins [BR:pda03400]
    103705614
Enzymes [BR:pda01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103705614
    6.5.1.6  DNA ligase (ATP or NAD+)
     103705614
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103705614
DNA replication proteins [BR:pda03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103705614
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103705614
DNA repair and recombination proteins [BR:pda03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103705614
   NER (nucleotide excision repair)
    Other NER factors
     103705614
   MMR (mismatch excision repair)
    Other MMR factors
     103705614
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DRMBL UBA_4 RMMBL Lactamase_B_2 CUE
Motif
Other DBs
NCBI-GeneID: 103705614
NCBI-ProteinID: XP_008787626
UniProt: A0A2H3XR81
LinkDB All DBs
Position
Unknown
AA seq 1405 aa AA seqDB search
MAALRSSTTKTRTLTSSSVFLDSYRSYSNLSPPTAPSLAFDLLSRGSPLPPIPPDFPRSK
LIPRTRFIVDGFRSAGDFSVSYFLSHFHSDHYAGLSPSWSKGLIFCSETTARLVVEILNI
LPFFVVSLSLGETVEIDGWDVTAVDANHCPGAVQFLFKAHGSEGHRPEMYVHTGDFRFRD
SMKLDPTLCEFIGADAVFLDTTYCNPKYVFPSQEESVEYVVSTIKRIRDQNKGPRESVLF
LIATYVVGKEKILLEISRRCDCLLHVDGRKMGILSVLGFGDSGVFTQDISASNIHVVGWN
LLGETWPYFRPNFVKMKELMTERGYSKAVGFVSTGWMYETKKDGFATRVKESLEIHLVPY
SEHSNYEELREYVRFLRPKHVIPTVGMDVEKLHGKHAVALQKHFAGLVDETANKHEFLMA
FHQKLGDADTMAGKDVASNTDKQDSAEGRESSYSEPLQSGEKSHLQVPYMSNDEDMAGGI
KELKDCLPSWVTQNQILGLLKSSGGDIVAAASHFFEHETEFYEQAKAVTLSVPRNQNNCT
EIESFPSQKSTQGQSICGLKNYLDNAKTPTRQKPTSPSSNLPKKRGLGTGNKPKKKGKSS
SGLESSGCKQTTITKFFGRLEARASHDDGPCIVTADRLLENGNQTLTDADETYKQELDQF
LQIIGGSMQRDSAALLLEQTKGNIDVAVDMYFSGSKLASGSKEILFSCSAHVDKDESLAS
SCTSKANISFEATTNLPTLFVRGSSTEDTTINNVSLPMEKYSPVEHACWKAGQPAPYLHL
ARTFDLVEREKGKIKTTVMLCNMFRSLLALSPDDVLPAVYLCTNRIAADHENMELNIGGS
LVITALEEACGTSRSRIKEMYKTSGDFGDVAQECRQTQSLLGPPRPLSIHNLFCVLQKIS
VTTGAGSAIRRKNLAVNLMRSCREMEIKFLVRTLVRNLRIGAMMKTILPALAQAVVLNSY
SRTQHMGSLESLKSQLQGISAAVAEAYNILPNLDLLIPSLLSKGIDFSASTLTMVPGTPI
PPMLARITNGVSQVLKLFQGRAFTCEYKYDGQRAQIHKLADGSIRVFSRHMKESTSRFPD
LIHIVKEIYKPEFSTFILDAEVVAVDRKNGCKLMSFQELSSRERGRKDSSITVNSIKVDI
CIFIFDLMFSNGERLLEFPLRQRRKCIKDLFHSEKIGYLEFAREITVEAEEAFLSNQNTL
TKINSFFEDACNSSCEGIMVKTLDVDAGYFASKRSEAWLKVKRDYVEGLGDCLDLVPIGA
WHGNGRKAGWYSPFLMACYNPDAEEFQSVCRVMSGFSDSFYKEMKEFFSGEKILSKKPPY
YQTDESPDLWFPPELVWEIRGADLTISPVHHAAVGLVHPSRGISVRLPRFVRPVLDRKPE
DCSTSADIACMFKSQTRRMEVSKED
NT seq 4218 nt NT seq  +upstreamnt  +downstreamnt
atggccgctctccggtcgtctactaccaaaactcgaactctaacctcctcctccgtcttc
ctcgactcctatcgatcctactccaacctctcccctcccaccgccccttccctcgccttt
gatctcctctcccgtggctcccctctccctccgatccctcccgacttcccccgctccaag
ctcattcccaggacccgcttcatcgtcgacggattccgctccgccggcgatttctccgtc
tcctacttcctctcccacttccactccgaccactacgccggcttgagccctagctggtcc
aaaggcctcatcttttgctccgagaccaccgcccgtctcgttgtggagatcctcaatatc
ctcccttttttcgtagtctccctttctctcggcgagactgtggagattgatggatgggat
gtcacagcggtcgatgcgaaccactgtccaggcgctgtccagttccttttcaaggcccac
gggtccgagggacaccgcccagagatgtacgtacacaccggtgatttccgtttccgtgat
tcgatgaaattggatcccactttgtgtgaatttattggtgctgatgctgttttcttggac
acaacttactgcaatccgaaatatgtgtttccctctcaagaggaatcagtggagtatgtt
gtgagcactatcaaaagaatcagggatcaaaataagggaccacgggagagtgtcctgttc
ctgattgctacttatgttgtaggaaaagagaagattttgcttgagatatcacgccggtgt
gactgcttattacatgtggatggtaggaagatggggattttgtccgtgttagggtttggc
gactctggggtttttacacaggatatttctgcaagcaatattcatgtggttggttggaac
ctactgggtgaaacttggccgtacttccgacccaattttgtgaagatgaaggagcttatg
acagagagaggttattcaaaggcggtgggttttgtttcgactgggtggatgtatgaaact
aagaaagatggctttgcgacgagggttaaggaatcgctcgagattcatcttgttccatac
agtgaacattcgaactatgaggaattaagagagtatgttagattcttaaggccgaaacat
gttattcccactgtgggcatggatgttgagaaactacatggtaaacatgctgttgctttg
cagaagcattttgcaggtttggttgatgaaacagcaaacaagcacgagtttctcatggct
ttccatcagaagctgggggatgctgatactatggctggaaaggatgtggcatctaataca
gacaagcaagacagtgcagaaggaagggagagttcatattcggagccattgcaatcaggg
gagaaatctcatctgcaagtcccatatatgtcaaatgatgaggacatggctggaggtatc
aaagagcttaaagattgcttgccatcttgggtgacccagaatcagattttaggtttgctg
aaaagctcgggtggagatattgttgcagcagcttcgcatttttttgagcatgaaaccgag
ttctatgagcaagcaaaggctgtcactctttcagtccccagaaatcaaaacaactgcact
gaaattgaatcttttccttctcagaaatctactcaagggcaatccatatgtggtttaaag
aattatttggataacgctaaaacaccaaccaggcagaagcctacatcaccgagttctaat
ttgcccaaaaaaaggggtttaggtactggaaataagccaaaaaagaaaggaaaatctagc
tcaggcttagaatccagtggatgcaagcagactacaatcaccaaattttttggaagactt
gaagctcgtgcttctcatgatgatggaccttgtatagttactgctgatcgtcttctggaa
aatgggaatcaaacgctaactgatgccgatgaaacatacaaacaagagttggatcagttt
cttcaaataataggtggttctatgcagagagactctgctgccttattactggagcagaca
aaaggaaacattgatgtagcagttgatatgtatttcagtggttctaagcttgcatctggt
agcaaggaaattttattttcttgcagtgcccatgttgacaaggatgagagccttgctagt
agttgtacttcaaaggccaacatttcttttgaggcaacaacaaacttgcctactttgttt
gtacgaggttcttcaacagaggacacaactataaataatgtatcattaccaatggaaaag
tattctcctgttgagcatgcttgctggaaggctggacagcctgctccctacttgcacctg
gcacgtacatttgatttggtggaacgagaaaaaggcaaaataaaaaccactgtgatgctt
tgcaacatgttcagaagcttgcttgctttatctcctgatgatgtgctacctgctgtgtac
ctatgcacaaacagaattgctgctgaccatgaaaacatggaactaaacattggtggcagt
ctggtcataactgcattggaagaggcttgtgggacaagcaggtctagaattaaagaaatg
tacaaaacttctggtgattttggtgatgttgcgcaagaatgccggcagactcaatcattg
cttggtcctcctcgccctctttctattcataatttattttgtgtgcttcagaagataagt
gttacaacaggtgctggaagtgctattcgaagaaaaaatcttgctgtaaatcttatgcgt
tcttgtagagaaatggaaataaagtttcttgttagaactttggttcgtaatttgcgtatt
ggagctatgatgaaaaccattttaccagcactagcacaagctgtggtgttgaacagctac
tctcgaacgcagcacatgggatccctggagagcctaaaatcgcagcttcagggcatctct
gcagcagttgctgaggcctacaatatacttccaaatttggatttgcttattccttctctt
ttgagcaagggcattgatttttcagcatcgactttaacaatggtgccaggcacaccaatt
cctcctatgcttgctagaattaccaatggtgtttcacaagtgttgaagttatttcagggt
agagctttcacctgtgaatacaaatatgatggtcaacgtgcccaaattcacaaactagca
gatggatctatacgagtattttcacgacacatgaaagaatcaacatctagattccctgat
ttgatacatattgttaaggaaatatataagcctgaattctcaactttcatactggatgct
gaggttgtagcagttgataggaagaatggctgcaagcttatgtctttccaagaactgtca
tcacgggagagaggaagaaaagattcgtcaatcacagtgaacagcattaaggttgatatt
tgcatcttcatctttgatctcatgttttctaatggagagcgactgttggaatttccgctc
cgtcaaaggaggaagtgtataaaagatttgtttcatagtgaaaagatcggctacctagaa
tttgcaagggaaataacggtggaagcagaagaagcatttctgagcaatcaaaacacattg
actaagataaattcattttttgaagatgcatgcaactcctcgtgtgaaggaataatggtg
aaaactttggatgttgatgctggatattttgcatcaaaacgtagtgaagcctggctaaag
gtgaaacgtgactatgtagaaggattaggtgattgtcttgatttagttcctattggtgct
tggcatgggaacggaagaaaagcaggatggtacagtccttttctaatggcatgctacaat
cctgatgctgaagaatttcaaagtgtgtgtcgtgtgatgtcaggtttctcagattctttc
tataaagagatgaaggaatttttttctggtgaaaagattttgtccaagaagccaccttac
tatcagacagatgagtcgcctgatctatggttccctccggagcttgtctgggaaatacgg
ggcgcagacctcacaatctctccagtgcaccatgctgctgttggcttagttcatccatct
cgaggtatctcggtgagactaccgaggtttgtgcgtcctgtattggaccgaaagccagag
gattgcagcacgtcagctgatattgcctgcatgtttaagtctcagactagaaggatggag
gtgagcaaggaagactga

DBGET integrated database retrieval system