KEGG   Phoenix dactylifera (date palm): 103706762Help
Entry
103706762         CDS       T03274                                 

Definition
(RefSeq) hexokinase-2-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00010  Glycolysis / Gluconeogenesis
pda00051  Fructose and mannose metabolism
pda00052  Galactose metabolism
pda00500  Starch and sucrose metabolism
pda00520  Amino sugar and nucleotide sugar metabolism
pda01100  Metabolic pathways
pda01110  Biosynthesis of secondary metabolites
pda01200  Carbon metabolism
Module
pda_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pda_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103706762
   00051 Fructose and mannose metabolism
    103706762
   00052 Galactose metabolism
    103706762
   00500 Starch and sucrose metabolism
    103706762
   00520 Amino sugar and nucleotide sugar metabolism
    103706762
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103706762
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pda04131]
    103706762
Enzymes [BR:pda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103706762
Membrane trafficking [BR:pda04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103706762
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 103706762
NCBI-ProteinID: XP_017698415
UniProt: A0A2H3ZPT0
LinkDB All DBs
Position
Unknown
AA seq 493 aa AA seqDB search
MGKAVVAAAMAVCTVAALVVRRRLRSVARSARAVEMVRELEERCATPIGLLKEVANAMAM
EMQAGLASEGDSKLKMLLSYVDSLPSGDEKGLFYALDLGGTNFRVLRVQLGGKERHVVKR
ESTEVSIPPHLMVGNSAELFEFIAAELAKFVASEGDDFHLSVGSQREIGFTFSFPVKQSS
ITSGTLVKWTKGFSIDEMVGKDVVVELTKAIEKQGLDMRVAALVNDAVGTLAGGRYYDKD
VVVAVILGTGTNAAYVEHAHAIPKWNGLLPKSGDMVINMEWGNFWSAHLPITEYDQDLDF
ESLNPGEQIFEKLISGMYLGEIVRRVLVKLAEETSLFGDTVPSKLRTPFILRTPEMSAMH
HDATSDLRIVGNKLNDILGIASTSMETRKLVVEICDIIAKRGARLAAAGVVGVLKKQGRD
AACGGKQRTVVAMDGGLFEHYKIFSECLDGTLRELLGEASQSVVIKLANDGSGIGAALLA
ASHSQYKEELCAS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggcggtggtggcagcggcgatggcggtttgcacggtggcggcgctggtggtg
cggcggaggctccggagcgtggcgcggtcggctcgggcggtggaaatggtgagggagctg
gaggagcggtgcgccaccccgatcgggctgctgaaggaggtggcgaacgccatggccatg
gagatgcaagccggcctcgcctcggagggcgacagcaagctcaagatgctcctcagctac
gtcgatagcctcccctctggggatgagaaaggactgttttatgctttggaccttggagga
acaaattttcgtgttttgcgtgtacagctgggtggaaaggaaaggcatgttgtaaaacga
gaatccacagaggtctccattccaccacatttgatggttggaaattcagctgaactattt
gaattcatcgctgcagaattagcaaaatttgttgcttcagaaggtgatgattttcaccta
tccgtgggcagtcagagggaaattggttttacattctctttcccagtgaagcaatcttca
attacatcaggcactcttgtcaagtggactaagggcttctccattgatgaaatggttgga
aaagatgtggttgttgaattgactaaggctattgaaaagcaaggtcttgatatgcgtgtt
gcggcattggtcaacgatgctgttgggacattggccggaggcagatactatgataaagat
gttgttgttgctgttatattgggtactggaacaaatgcagcatatgtagagcatgcacat
gcaattcccaagtggaatggcctcctaccgaaatcaggagatatggttatcaacatggaa
tggggtaacttctggtcagctcatcttcctatcacagaatatgatcaagacttggatttt
gaaagtttgaatcctggggaacagatctttgagaagttaatttcgggaatgtatttagga
gaaattgtacgtagagtcctagtgaaactggctgaagagacttccctttttggcgacact
gttccatcgaaacttagaactccttttatactacggaccccggaaatgtctgccatgcat
catgatgcaacatctgatctcagaatagttgggaacaagctgaacgatatcttagggatc
gctagtacctccatggagacaagaaaactggtggttgaaatctgcgatatcatcgcaaag
cgtggtgcgcgcctggctgctgcaggagtagtgggtgtcctcaagaagcaggggagggac
gctgcttgtggtggcaagcagaggacggtggtcgccatggatgggggactgtttgagcac
tacaagatattcagcgagtgcttggacggcactctcagggagctgcttggggaggcatcg
cagtctgttgtcatcaagcttgctaatgatggttccggtattggagctgcactccttgca
gcctctcactctcagtacaaggaggagctctgtgcatcctga

DBGET integrated database retrieval system