KEGG   Phoenix dactylifera (date palm): 103707141Help
Entry
103707141         CDS       T03274                                 

Definition
(RefSeq) glutamate--glyoxylate aminotransferase 2
  KO
K14272  glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00220  Arginine biosynthesis
pda00250  Alanine, aspartate and glutamate metabolism
pda00260  Glycine, serine and threonine metabolism
pda00630  Glyoxylate and dicarboxylate metabolism
pda00710  Carbon fixation in photosynthetic organisms
pda01100  Metabolic pathways
pda01110  Biosynthesis of secondary metabolites
pda01200  Carbon metabolism
pda01210  2-Oxocarboxylic acid metabolism
pda01230  Biosynthesis of amino acids
Module
pda_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
pda_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    103707141
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    103707141
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103707141
   00260 Glycine, serine and threonine metabolism
    103707141
   00220 Arginine biosynthesis
    103707141
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pda01007]
    103707141
Enzymes [BR:pda01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     103707141
    2.6.1.4  glycine transaminase
     103707141
    2.6.1.44  alanine---glyoxylate transaminase
     103707141
Amino acid related enzymes [BR:pda01007]
 Aminotransferase (transaminase)
  Class I
   103707141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 103707141
NCBI-ProteinID: XP_008789746
UniProt: A0A2H3XWC6
LinkDB All DBs
Position
Un
AA seq 481 aa AA seqDB search
MTPKPLDYESLNENVKKVAYAVRGELYLRAAELQKEGKKIIFTNVGNPHALGQKPLTFPR
QVVALCQAPFLLDDPNVGLLFPADAISRARHYLSMTSGGLGAYSDSRGLPGIRKEVADFI
GKRDGYPSDPELIFLTDGASKGVMQILNTIIRDENDGILVPVPQYPLYSATISLYGGSLV
PYFLEEEANWGLDFYNIRQSVAAARSRGITVRAMVIINPGNPTGQCLSEANIRELLEFCF
QENLVLLADEVYQQNIYQDERPFVSARKILFDMGPPMSKEVQLVSFHTVSKGYWGECGQR
GGYFEMTNLPSQTVDEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYLKFVQESKAVL
ESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAARKAGKAPDVFYCLGL
LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASFRKFNDEFMEQYENCRGYSR
M
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgaaaccgctggactacgagtcgctgaacgagaatgtgaagaaggtcgcgtat
gccgtcagaggagagctttatctacgggctgccgagctgcagaaggaagggaagaagatc
atatttacaaatgtgggcaacccccatgctctaggacagaagccattgacatttcctcgt
caggtggtagcattatgtcaagctccatttttgctagatgatcctaatgttggacttctc
ttcccagcagatgccatttcaagagctagacattatctttcaatgacttcgggtggttta
ggtgcatatagtgattctcgaggtcttcctggaatcaggaaggaagttgctgattttatt
gggaagcgtgatgggtaccctagcgatccagagcttatatttctcaccgatggtgccagt
aaaggtgtcatgcagatactaaacaccattatcagagatgagaacgatgggattttagtt
ccggttccccagtaccccctttattcagctacaatatcattatatggtggttctcttgtc
ccatattttttagaagaggaggcaaactggggtcttgacttctataatattcgccaatct
gtggcagcagcacgttcaagagggataactgttcgagctatggtgatcataaacccagga
aaccctacgggtcaatgtctcagtgaggccaacataagggaattgttggaattttgtttc
caagaaaatctagtcctgcttgcagatgaagtttatcagcaaaacatatatcaggatgaa
cggccctttgtaagtgcaagaaagattctgtttgacatgggtccacctatgagcaaagag
gtccaacttgtctctttccacactgtgtcaaaaggatattggggagaatgtggacagcgt
ggaggatactttgagatgaccaatcttccttctcagacggtagacgagatctacaaggtt
gcatctatttcactcagtccgaatgtccctgggcagatctttttagggctgatggttaat
cctcccaaaccaggagacatttcatacttgaagtttgttcaagagagcaaggctgttctc
gagtctcttaggagaagagcacaaataatgaccgatggatttaatagttgcagaaatgtg
gtttgcaattttacagaaggagccatgtattcattcccacaaatacgcttaccaccaaaa
gcaattgaagctgccagaaaggctggcaaagctcctgatgttttctattgcctcgggctc
ttggaagcaactggcatttccactgttccaggctcaggttttggccagaaagaaggggtt
ttccatctaagaacaaccatcttgccagcagaggaagacatgcctgcaatcatggctagt
ttcaggaaattcaatgatgagtttatggaacaatacgaaaactgcagaggctactcgagg
atgtaa

DBGET integrated database retrieval system