KEGG   Phoenix dactylifera (date palm): 103708253Help
Entry
103708253         CDS       T03274                                 

Definition
(RefSeq) histone deacetylase 5-like isoform X1
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
pda  Phoenix dactylifera (date palm)
Brite
KEGG Orthology (KO) [BR:pda00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pda01009]
    103708253
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pda03019]
    103708253
   04131 Membrane trafficking [BR:pda04131]
    103708253
   03036 Chromosome and associated proteins [BR:pda03036]
    103708253
Enzymes [BR:pda01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103708253
Protein phosphatases and associated proteins [BR:pda01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103708253
Messenger RNA biogenesis [BR:pda03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     103708253
Membrane trafficking [BR:pda04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    103708253
Chromosome and associated proteins [BR:pda03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     103708253
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 103708253
NCBI-ProteinID: XP_008791310
UniProt: A0A2H3XZX4
LinkDB All DBs
Position
Unknown
AA seq 691 aa AA seqDB search
MAALDDPRRRRVGLLYDERMCRHATPDGESHPENPERIRTIWRKLESEGIPQRCVVMSAK
EAEDKYIAPVHTQSHIKLIRNISSKKFDSQRLRIASKFNSIYFNKGSSEAAYLAAGSVVE
VSEKVAKGDLDSAIALVRPPGHHAESDEAMGFCLFNNVAIAANFLLNERPELGIRKILIV
DWDVHHGNGTQNMFYKDPRVLFFSVHRFDFGSFYPAGDDGSYCMVGEGPGAGYNINIPWE
HGQCGDADYLAVWDHVLLPVVESYNPDIILISAGFDAAVRDPLGGCCVTPYGYSLLLKKL
MGFARGKIVMALEGGYNLNSIANSVLACAKVLLEEKPIVGSIEVQPFESTWRVIQEVRHE
LKTFWPALAVELLQKVLVCNSRPCPVELNLSSSSESDVESDVGASSSIYSSNFVEIIEPL
SKLNIVEDNQGKAIVSNQIPAEQNPIFLCDECSNAQALMPDNNVHACIPWRSVLSNIEVW
YGSYGSNMWKPRFLCYIEGGKVEGMNKPCPGSRDKSSPKVVIWKTVPHRLFFARSHTRTW
GEGGVAFLHPESNKNEKAYMCMYRITLEQFNDVLFQENNLHQENGKSQGAIEPLLDLSEI
GIVAENKSLPLEALKAGWYSNVLYLGKEDNLPILTMTCLFSEVEQFKSGELPVTGPSNNY
MNTLVRGLVEGKQLTREKAIAYINDAAGRGL
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctggatgatccccgccgccggcgcgtaggcctcctgtacgacgagcggatg
tgccgccatgccacccccgacggcgagagccacccggagaatcccgagcggatccgcacc
atctggcggaagctcgagtccgaggggattccccagagatgtgtagttatgagcgccaag
gaagctgaggataagtacatagcacctgttcatacccaaagtcatatcaagctgatcagg
aatatcagctctaaaaaatttgattctcaacgtcttaggattgcctcaaagttcaattct
atatattttaacaagggttcatctgaagctgcttaccttgcagcaggttcagttgttgag
gtgtctgaaaaggtggccaaaggagatttggattctgctattgcccttgtgaggcctcct
ggacaccatgcagaatctgatgaagctatgggattttgtctcttcaacaatgtcgcaatt
gcagctaattttctcttgaatgaaaggccagagttaggtattagaaagatactaattgtg
gattgggatgttcaccatggcaatggaactcagaatatgttttacaaggacccccgggta
ctgttcttttcggttcacaggttcgattttggaagcttttatccggctggtgatgatggg
tcatattgcatggttggtgaaggtccaggtgcaggatataacatcaatattccttgggaa
catggacaatgtggtgatgcagactatttagctgtctgggaccatgtattgcttcctgta
gttgaatcttacaatcctgacataatattaatttctgctggatttgatgcagctgttcgt
gatccacttggtggttgttgtgtcacaccatatggatattcacttttgttgaaaaaactg
atgggatttgctcgaggaaagatagtgatggccctggaaggaggttacaatcttaattct
atagcaaattcagttcttgcttgtgcaaaagttttattggaagaaaaacccatagttgga
tccatagaggtgcaaccttttgagtctacatggcgtgtcatacaagaggttcgtcatgaa
ctaaagacattctggccagcattggctgttgagttactacagaaagtattggtttgcaac
agtagaccttgcccggttgagctaaacttgagctctagctctgagtctgatgtggagagt
gatgtgggagcttccagctctatatattcctcaaactttgttgagattattgagcccctt
tcgaagttgaatattgttgaagataatcaagggaaagcgattgtctccaaccaaattcca
gctgagcaaaatcccatttttttatgtgatgaatgttctaatgcacaagcattgatgcct
gataacaatgttcatgcttgcattccttggagatcagttttatctaatattgaagtctgg
tatggaagctatggatcaaatatgtggaaaccaaggtttctctgctacattgaaggcgga
aaggttgaaggtatgaacaaaccatgtcctggatcgcgagataaaagttcaccaaaagtt
gtcatctggaaaactgtgccccatcggttattctttgcaagatctcacactcgcacatgg
ggtgaaggaggtgttgcttttcttcatcctgaaagcaacaagaatgagaaagcctacatg
tgcatgtatagaataacgctcgagcagttcaacgatgtattatttcaagagaataattta
catcaagagaatggcaaaagtcaaggtgcaatagagcctttactagatttatctgagata
ggtattgttgctgaaaacaagtcattgcctctagaggctcttaaggctggatggtattcc
aatgtcctttatttggggaaagaagataaccttccaatcttaactatgacgtgcttattt
tcagaggttgagcaatttaaatctggtgaattacctgtaactggcccttcaaataattac
atgaatacattagtgagaggattggtagaaggaaaacagcttaccagagagaaagcaatt
gcttacattaatgatgctgctggcagagggttataa

DBGET integrated database retrieval system