KEGG   Phoenix dactylifera (date palm): 103708620Help
Entry
103708620         CDS       T03274                                 

Definition
(RefSeq) glutamate decarboxylase 4-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00250  Alanine, aspartate and glutamate metabolism
pda00410  beta-Alanine metabolism
pda00430  Taurine and hypotaurine metabolism
pda00650  Butanoate metabolism
pda01100  Metabolic pathways
pda01110  Biosynthesis of secondary metabolites
Module
pda_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    103708620
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103708620
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103708620
   00430 Taurine and hypotaurine metabolism
    103708620
Enzymes [BR:pda01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     103708620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 103708620
NCBI-ProteinID: XP_008791858
UniProt: A0A2H3Y122
LinkDB All DBs
Position
Unknown
AA seq 496 aa AA seqDB search
MVLSAAGSEPDASVDYTFASRYVCAALPRFKMPENSIPKDAAYQIISDELMLDGNPRLNL
ASFVTTWMEPECDKLIMAATNKNYVDMDEYPVTTELQNRCVNMIAHLFHAPVGDDETALG
VATVGSSEAIMLAGLAFKRKWQNKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLREGFYIMDPVKAVEMVDENTICVAAILGSTLTGEFEDVKLLNQLLTQKNKETGWDTP
IHVDAASGGFIAPFLYPQLEWDFRLPLVKSINVSGHKYGLVYAGVGWVVWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQIIAQYYQFLRLGFEGYKNIMKNCMENARVLREGLEK
MGRFDIVSKEVGVPLVAFSLKDSSKHTVFQIAENMRKFGWIIPAYTMPHDAEHVAVLRVV
IREDFSRSLAERLISDIKKVLGELDAVPSQPITIAHVTPVKNAEGTVLKKSILETQQEIT
TYWRRLVERKKTNGVC
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggttctctccgcggcaggatccgagcccgacgcttcggtcgactacaccttcgcctct
cgttacgtttgtgccgcccttcctcggtttaagatgccggagaattcgataccgaaggac
gcggcgtaccaaatcatcagcgacgagctgatgctggatgggaatccgaggctgaacctg
gcatcgttcgtcacgacgtggatggagccggagtgcgataagctcattatggctgccacc
aacaagaattacgtcgacatggatgagtaccctgtcaccaccgagctccagaaccgctgt
gtaaatatgatagcccatctttttcatgccccagttggggatgatgaaacagcactaggg
gttgcaactgtgggatcctcagaagcaataatgctggcaggactggcatttaagaggaag
tggcaaaacaaaagaaaggcagagggaaagccttatgacaagccaaacattgttactggt
gcaaatgttcaggtttgctgggagaaatttgcaaggtattttgaagttgaattgaaggaa
gtgaagttaagggaggggttttatatcatggatcctgtgaaggctgtggagatggtggat
gagaataccatctgtgttgctgccattttgggttctactctcactggagagtttgaagat
gttaaactactgaaccagctgcttacacagaagaacaaggaaacagggtgggatacacct
attcatgttgatgctgcgagtggcggattcatagctcctttcctctatccacagctggag
tgggattttcggctaccactggtaaagagcataaatgttagtggtcacaaatatggtctt
gtttatgctggagttggttgggttgtttggaggagcaaggaagatttgcctgaagagctc
attttccatataaactatcttggggcagatcaacctacttttaccctcaatttttctaaa
ggttcaagtcagattattgcacagtactaccagttcttgcgcttgggctttgagggctac
aagaatatcatgaaaaattgcatggaaaatgcaagagtgctaagggaaggcctcgagaag
atgggaaggtttgatattgtctcgaaggaagttggtgttcctcttgttgcattctcgctt
aaggacagcagcaagcacacagtctttcagatagcagagaacatgaggaagtttggatgg
ataatccctgcatacacaatgccacatgatgccgagcacgtggccgtccttcgtgtcgtg
atcagggaggacttcagcaggagccttgccgaacgcctcatttcagacatcaagaaggtc
ctgggagagcttgacgctgttccaagccagcccatcaccattgcccatgtaacacctgta
aagaatgctgagggtactgttcttaagaagagtattttggagacacagcaggagatcact
acatactggaggcggcttgttgagcgtaagaagactaatggagtttgctaa

DBGET integrated database retrieval system