KEGG   Phoenix dactylifera (date palm): 103709462Help
Entry
103709462         CDS       T03274                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase, housekeeping isozyme
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00620  Pyruvate metabolism
pda00710  Carbon fixation in photosynthetic organisms
pda01100  Metabolic pathways
pda01200  Carbon metabolism
Module
pda_M00168  CAM (Crassulacean acid metabolism), dark
pda_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
pda_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
pda_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    103709462
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    103709462
Enzymes [BR:pda01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     103709462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 103709462
NCBI-ProteinID: XP_008793018
UniProt: A0A2H3Y434
LinkDB All DBs
Position
Unknown
AA seq 966 aa AA seqDB search
MSRNGVEKLASVDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC
YELSAEYEGKRDPSKLDELGNVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK
LKKGYFADENSAATESDIEETLKRLMVQLKKSPAEVFDALKSQTVDLVLTAHPTQSVRRS
LLQKHARIRNCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPAPQDEMRAGM
SYFHETIWKGVPKFLRRIDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYYSQIEDLMFELSMWRCNDELRVRADELHRFSKKDAAKHYIEFWKQV
PPNEPYRVILSDVRDKLYNTRERSRHLLSNGYSDIPEEATFTNVEQFLEPLELCYRSLCA
CGDRPIADGSLLDFLRQVSIFGLSLVRLDIRQESDRHTDVIDAITKHLGIGSYREWSEEK
RQEWLLSELNGKRPLFGPDLPKTEEITDVLDTFHVIAELPSDNFGAYIISMATAPSDVLA
VELLQRECRVKKPLRVVPLFEKLADLEAAPAALARLFSIDWYRNRIDGKQEVMIGYSDSG
KDAGRFSAAWQLYKAQEELIKVAKLYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIH
GSLRVTVQGEVIEQSFGEEHLCFRTLERFTAATLEHGMHPPISPKPEWRALMDEMAAIAT
REYRSIVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTR
FHLPVWLGFGAAFKHVMEKDIRNLHMLQVMYNEWPFFRVTIDLVEMVFTKGNPGIAALYD
KLLVDEELWPFGERLRANYEETKQLLLQVAGHKDLLEGDPYLKQRIRLRDAYITTLNVCQ
AYTLKQIRDPSYHVKVRPHLSKEIMESSKPAAELVKLNPTSEYAPGLEDTLILTMKGIAA
GLQNTG
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atgtctcggaacggggtggagaagttggcctcggttgatgcgcagctgaggcttctggcg
ccgcgcaaggtgtcggaagatgataagctggtcgaatatgacgcgctcctcttggatcgg
tttcttgatattctccaggacttgcatggcgaggatattagggaaacggttcaagagtgc
tatgagctatctgcagagtatgaagggaagcgtgatcctagcaagcttgatgagctgggg
aatgtgctgacaagtttggacccaggtgactccattgtggtcacgaagtcgttttcacac
atgcttaacttggccaacttggctgaggaggtccagattgcctaccgtaggagaatcaag
ctgaaaaaaggatattttgctgatgaaaattctgcggctactgaatcagacattgaagag
acccttaaaaggctcatggtgcagctgaagaagtccccagcagaggtctttgatgctctg
aagagccagacagttgatctggttttgactgcacacccgactcagtcggtcaggagatcg
ctgcttcagaaacatgcaaggataaggaattgtttggcacaattgtatgccaaggatatt
actcctgatgacaagcaggagcttgatgaggctcttcagagagagattcaagctgccttt
agaacagatgagatacgtagaactcctcccgctcctcaagatgaaatgcgggctggaatg
agctattttcatgagacaatatggaaaggtgttccaaagttcttacgtcggattgataca
gctctgaaaaacattggaataaatgagcgtgtgccttataatgcccctcttattcagttt
tcttcttggatgggtggagatcgtgatggaaatcctagagtgactccagaagtgacaagg
gatgtgtgcttgttggctcgaatgatggctgcaaatctgtactattcccaaatagaagat
ctaatgtttgagctttctatgtggcgctgcaatgatgagctccgagtacgagcagatgag
ctacaccgcttctcaaaaaaagatgctgcaaaacattatatagaattttggaaacaagtt
cctccaaatgagccttaccgtgttatacttagtgatgtcagagataagctatacaataca
cgtgagcggtcccgccatttattgtcgaatggatattcagatatccctgaggaagcaact
ttcaccaatgttgaacagttcctggagcctcttgagctatgttacagatctctctgtgct
tgtggtgatagaccaattgctgatggaagccttcttgactttttgcgccaagtatcaata
tttggactgtcacttgtgagacttgatatccggcaagaatctgacaggcacactgatgtt
attgatgccatcaccaagcatctaggaattggatcatatcgtgaatggtcagaagaaaaa
cgtcaggaatggctgttgtctgaacttaatggaaagcgccctttgtttggccctgacctt
cccaaaactgaggaaataactgatgttttagatacattccatgtcattgcagaacttcct
tcagacaattttggggcatatatcatctcaatggcaactgctccatcagatgtcctggct
gttgagctgttgcagcgtgagtgccgtgtgaagaaacctctgagagttgtccctctgttt
gagaaacttgcagatcttgaggcagcccctgctgctttagcccgactcttttcaatagat
tggtacaggaaccggattgatggaaaacaggaagtcatgattggatattcggattcaggg
aaggatgctgggcgtttttctgcagcttggcagttatacaaagctcaggaagagcttata
aaggtcgccaagctatatggagtgaaactgacaatgttccatgggcgaggagggactgtt
ggaagaggaggtggtccaactcatcttgctatattatctcagccaccagacacgatccat
ggatcacttcgggtcacggtccaaggcgaagttattgagcagtcatttggagaggagcat
ttgtgcttcagaacactcgaacgattcacagctgctactcttgaacatggaatgcatccc
cctatttctccaaagccggaatggcgtgcattgatggatgagatggctgctatagccaca
agggaataccgatcaattgtattccaagaaccacgtttcgttgaatatttccgcctagca
actccagagcttgagtatggtaggatgaacattggcagcagaccatcaaaacgaaagcct
agtgggggcatagaatcactgcgtgcaatcccttggatctttgcatggacacaaacacgt
tttcaccttccagtgtggcttggctttggagcagcatttaagcatgtcatggaaaaagat
atcaggaatcttcacatgcttcaggtgatgtacaatgagtggccatttttcagggtcacc
attgacttggttgagatggttttcaccaagggaaatcctggcatagctgctttatatgac
aaattgcttgtggatgaagaattatggccatttggtgaacgactaagagccaactacgaa
gaaacaaagcaacttcttcttcaggttgctggtcacaaagatctcctcgaaggggatcca
tacttgaaacagagaatacggctgcgtgatgcatatatcacaactctgaatgtttgccaa
gcttatactctgaagcagattagagaccccagttaccatgtgaaggtgagaccacatctg
tcaaaggagataatggagtctagcaagccagctgcagaattggtgaagctaaaccccaca
agtgagtatgcccctgggctggaggataccctcattctgactatgaagggtatagctgct
ggcttgcagaacacgggctaa

DBGET integrated database retrieval system