KEGG   Phoenix dactylifera (date palm): 103710428Help
Entry
103710428         CDS       T03274                                 

Definition
(RefSeq) cinnamoyl-CoA reductase 1-like
  KO
K09753  cinnamoyl-CoA reductase [EC:1.2.1.44]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00940  Phenylpropanoid biosynthesis
pda01100  Metabolic pathways
pda01110  Biosynthesis of secondary metabolites
Module
pda_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    103710428
Enzymes [BR:pda01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.44  cinnamoyl-CoA reductase
     103710428
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 GDP_Man_Dehyd NAD_binding_4 NmrA adh_short KR Polysacc_synt_2
Motif
Other DBs
NCBI-GeneID: 103710428
NCBI-ProteinID: XP_008794349
UniProt: A0A2H3Y6Z4
LinkDB All DBs
Position
Unknown
AA seq 329 aa AA seqDB search
MTVDASTASGHGQTVCVTGAGGFIASWLVKLLLEKGYTVKGTVRNPDDPKNAHLKALEGA
KERLILCKADLLDHDALRAAIDGCQGVFHTASPVTDDPEEMVEPAVRGTRYVINAAADAG
TVCRVVFTSSIGAVTMDPKRGPDVVVDESCWSDLEYCKSTKNWYCYGKAVAEKAAWEMAK
ERGVEVVVVNPVLVMGPLLQGTVNASVKHVVKYLDGSAHKYANAVQAYVDVRDVALAHLL
VYEAPGAAGRYLCAETVLHREDLVRILAELFPEYPVPTRCSDEVNPRKQPYEFSNQRLKD
LGLHFTPVTRSLYETVKSLQEKGHLQIIA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcgatgcttccaccgcctccggccacggccagaccgtctgcgtaaccggcgcc
ggtggcttcatcgcctcctggctggtgaagctgctcctggagaagggctacaccgtcaaa
ggaaccgtccggaacccagatgatccaaagaatgcgcacttaaaagctctggaaggggcg
aaggagaggctgatcctctgcaaggctgatctccttgatcatgatgccctgcgggcggcc
atcgacgggtgccagggcgtcttccacaccgcttctccggtgaccgatgatccggaggaa
atggtggagccggcggtgagggggaccaggtacgtgatcaatgcagccgccgacgccggc
accgtctgccgcgtggtgttcacctcctcgatcggtgccgtgaccatggaccccaagcgc
gggcctgatgtggtggtcgacgagtcatgctggagcgacctggagtactgcaagagcacc
aagaattggtattgctacgggaaggcggtggcggagaaggcggcatgggagatggcgaag
gagaggggggtggaggtggtggtggtgaacccggtgctggtgatggggccgctgctgcag
gggacggtgaacgccagcgtgaagcacgtggtgaagtaccttgacggctcggcgcacaag
tacgccaacgcggtgcaggcgtacgtggacgtgcgggacgtggcgctggcgcacctcctc
gtgtacgaggcccccggggccgccggccgctacctctgcgccgagaccgtcctccaccgg
gaggacctcgtccgcatcctcgccgagctcttccccgaataccccgtccccaccaggtgc
tccgatgaggtaaatcctcggaagcagccatatgagttctcgaaccagcggctcaaggat
ctcggcctccacttcacgccggtgactcgcagcctctacgaaacagtaaagagcctgcag
gagaaaggacaccttcagatcattgcttga

DBGET integrated database retrieval system