KEGG   Phoenix dactylifera (date palm): 103711471Help
Entry
103711471         CDS       T03274                                 

Definition
(RefSeq) hexokinase-2-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00010  Glycolysis / Gluconeogenesis
pda00051  Fructose and mannose metabolism
pda00052  Galactose metabolism
pda00500  Starch and sucrose metabolism
pda00520  Amino sugar and nucleotide sugar metabolism
pda01100  Metabolic pathways
pda01110  Biosynthesis of secondary metabolites
pda01200  Carbon metabolism
Module
pda_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pda_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pda00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103711471
   00051 Fructose and mannose metabolism
    103711471
   00052 Galactose metabolism
    103711471
   00500 Starch and sucrose metabolism
    103711471
   00520 Amino sugar and nucleotide sugar metabolism
    103711471
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103711471
Enzymes [BR:pda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103711471
Membrane trafficking [BR:pda04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103711471
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Porphobil_deamC
Motif
Other DBs
NCBI-GeneID: 103711471
NCBI-ProteinID: XP_008795834
UniProt: A0A2H3YAD2
LinkDB All DBs
Position
Un
AA seq 526 aa AA seqDB search
MGKVAVGAAVVCAAAACAVAALVVRHRMRSSGRWARAMAILKDLEEKCATPIGKLRQVAD
AMTVEMLAGLASEGGSKLKMLISYVDNLPTGDETGLFYALDLGGTNFRVLRVQLGGKGGY
VVRQEFEEVSIPPNLMVGSSSELFDFIAAALAKFVASEGEEFHLPVGRQRELGFTFSFPV
KQTSISSGTLIKWTKGFAINGTVGEDVVAELTKAMEKQGLDMRVTALVNDTIGTLAGGRY
YDNDVVAAVILGTGTNAAYVEHAQAIPKWHGLLPKSGKMVINMEWGNFRSSHLPITEYDQ
ALDVESLNPGEQVISSSTSLSTKNWLFRFICTLFFYSQIFEKLISGMYLGEIVRRVLLRM
AEEAALFGDSVPPNLEVQFILRTPDMSAMHHDTSSDLRVVGTKLKDILGISNTSLKTRKL
VVKVCDIIASRGARLAAAGILGVLKKQDRDNAARDGSDMQRTVIAMDGGLYEHYTRFRNC
LETTLREMLGEEAAPSIVIKLASDGSGIGAALLAASHSQYLELEES
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggtggcggtgggagcggcggtggtgtgcgcggcggcggcatgcgcggtggcg
gcgctggtggtgcggcacaggatgcggagctccgggcggtgggcacgggcgatggcgata
ctgaaggacctggaggagaagtgcgccacgccgattgggaagctgaggcaggtggcggat
gcgatgaccgtggagatgctcgccggcctcgcttcggagggcgggagcaagctcaagatg
cttatcagctacgtcgataacctccccacaggagatgagacaggattgttttatgcattg
gaccttggaggaaccaacttccgtgtactacgtgtacaattgggaggaaagggagggtat
gttgtcaggcaagaatttgaagaagtttccattccaccaaatttgatggttggaagctcc
agtgaactatttgacttcattgctgcagcattggcaaagtttgttgcttcagaaggtgaa
gaatttcaccttcctgtgggcaggcagagagaacttggttttactttctctttccctgtg
aagcaaacatcgatctcgtctggcactcttattaagtggacaaagggttttgccattaat
ggcacggttggggaagatgtggtggctgagttgaccaaggccatggaaaagcaaggtctt
gatatgcgggttacagcattagtaaatgacacaattggcacattggctgggggcagatat
tacgataatgatgtggttgctgctgtcatactgggtactggaacaaatgcagcatatgta
gagcatgcacaagcaattcctaaatggcatgggcttttaccaaaatcaggaaagatggtt
atcaacatggaatggggaaatttcaggtcatctcatcttcctataacagaatacgatcaa
gcattagatgttgaaagtttgaatcctggtgaacaggtgatttcttcgtccacttctttg
agtacaaaaaattggttgttcagatttatatgtaccttatttttttattcccagatcttt
gagaagttaatttccggaatgtacttgggagaaattgtacgaagagtcctgttgagaatg
gctgaagaagctgccttgtttggagacagtgttccaccaaatcttgaagttcaatttata
ctgcggactccagacatgtcagccatgcatcatgacacatcatccgatctcagagttgtt
gggactaaactaaaggatattttagggatctctaatacctctttgaaaacaagaaagctg
gttgtcaaggtctgtgatatcattgccagtcgtggggcccgtctcgctgctgctggaata
ctgggcgtcttgaagaagcaggaccgtgataatgcagcaagggatggaagtgacatgcag
aggacagtgattgctatggacggtgggctttatgaacattacactagatttagaaattgt
ttggaaaccacactcagagagatgctcggagaagaggccgcaccgtctattgtcatcaag
cttgccagtgacggatcaggcattggagcagctctcctcgctgcatctcactctcagtat
cttgagcttgaagaatcctga

DBGET integrated database retrieval system