KEGG   Phoenix dactylifera (date palm): 103713764Help
Entry
103713764         CDS       T03274                                 

Definition
(RefSeq) histone-lysine N-methyltransferase EZ1-like
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pda00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    103713764
Enzymes [BR:pda01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103713764
Chromosome and associated proteins [BR:pda03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103713764
   Polycomb group proteins
    PRC2-EZH2 complex
     103713764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET TCR Peptidase_M41
Motif
Other DBs
NCBI-GeneID: 103713764
NCBI-ProteinID: XP_008799008
UniProt: A0A2H3YHZ0
LinkDB All DBs
Position
Un
AA seq 934 aa AA seqDB search
MASKASSSASASKSMPSTGLQITGIKEGNHTSQDILSVIDSLMKQVVADRYIYIKERMEE
NKQKLSSITQHLCNLSKFRRDTTSNNTNIDVNLLTKRQDDALCMLSSLELSGGEKDSSSC
QEESSYASSIVLIGSNYGGKNTVRPIKLPEVPKLPPYTTWIFLDRNQRMAEDQSVVGRRR
IYYDQSCGEALICSDSEDDVVDDEEEKRQFGSTEDFIIRMTIQKVGLSDAVLDSLAQCLE
RSTDEIRARYESIIKIEKTEECVKKGEGGVEIQTEDALSEKDLDAALDSFDNLFCRRCLV
FDCRLHGCSQDLVFPSEKQLPWSNSDDVTPCCGHCYKLVPKSERMVTMNSEVPHVFEEPT
QSSGSARASLSPKKKSQGSSVGRKAKSHQSESASSNARVVSESSESEVDPRQDAMSVQLS
SPLKIKQGGKSGIRKKDNKRIAERALVCMRKKQKKMVTPVPPDSDSIVNGCLWPHDMKLR
SNTRNGSKDSTSSSQNKLVKSPIIRSSRKKGLSHQDSINSAYIETQNDSTGEIGKESLAT
DCDESSRKEEFVDENSCRYENTRRKSWKMIEQSLFVKGLEIFGRNSCLIARNLLSGMKTC
MEVFQYMNYVEDKRTYGAADGANSLVEGHAKVDYNESMGNELQTRSRFLRRRGRVRRLKY
TWKSAGYHSIRKRITERKDQPYRQYNPCGCQSACGKQCPCLVNGTCCEKYCGCPKICKNR
FRGCHCAKSQCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGGPNQRGDNYECRNMKLL
LKQQQRVLLGRSDVSGWGAFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLF
NLNDQFVLDAYRKGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERISAGEELFYDYR
YEPDRAPAWARKPEASGSKKDEMQPSTGRAKKLA
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaaggcctcgtcttcggcttccgccagcaaatccatgccctccaccggcctt
cagatcaccggaattaaagaaggaaatcatacttctcaggatattttgtcagttattgat
tccttgatgaaacaagttgttgctgaccgttacatatatattaaggaaagaatggaagag
aacaagcagaaactcagtagcatcacgcaacatctttgtaatttatcaaagtttaggaga
gatacaacatcgaacaatactaacatagatgtaaatttgttaacgaaaaggcaagatgat
gcactttgtatgctaagtagtcttgaactatctggaggggaaaaagatagcagtagttgt
caagaagaaagttcatatgcctcgtcgattgtacttatagggagcaactatggaggaaag
aatacagttcgtccaatcaaactgccagaagtgccaaaattacctccatatactacatgg
attttcttggacagaaatcaaagaatggcagaggaccagtccgttgttggtcgtaggaga
atttattatgatcaaagttgtggtgaagctttgatttgcagcgatagtgaggatgatgta
gttgacgatgaagaagagaagagacagtttggaagtactgaagattttattattcggatg
accatccaaaaagttggtttatcagatgctgtgctggattcattggctcagtgccttgaa
aggagtactgatgaaatcagggcaagatatgagagcattataaagatagagaaaactgag
gagtgtgttaaaaagggagaaggtggagttgagattcaaactgaagatgcattatcagaa
aaagatctggatgcagcattggactcttttgataaccttttttgtaggcgatgtctagtt
tttgactgtagactgcatggatgttctcaagatttggtatttccttcagaaaaacaactt
ccctggagcaactcagatgatgtcacaccttgttgtggtcactgctacaaactggtccca
aaatcagagcgtatggttaccatgaattctgaggtgccacatgtttttgaagagccaaca
cagtcatctggtagtgctcgagcatcactgtctccaaaaaagaaaagtcaaggttcttct
gtagggaggaaagcaaaatctcatcaaagtgaaagtgcttcttctaatgcaagagttgtt
tcagaaagtagcgaatctgaagtagatcctcgacaggatgccatgtctgttcaactctct
tcacccttgaaaattaaacagggtggcaaatctggtattcggaagaaagacaacaaaaga
attgctgagcgggctcttgtatgcatgcggaaaaagcagaagaaaatggtgaccccggtg
cccccagactctgattccattgttaatggatgcctctggccgcatgatatgaagcttaga
tcaaatacacgcaatggcagtaaagattctacttcatcttcacagaacaaacttgtcaaa
tctccaataatcagaagttccagaaaaaagggactatcacatcaggacagtatcaattca
gcttacattgaaactcaaaatgattctactggtgagatagggaaagagtcactggccaca
gattgtgatgaaagttcaagaaaagaggagtttgttgatgagaacagttgcagatatgaa
aatactcgtcgtaaatcttggaaaatgattgagcaaagcctttttgttaaaggtctggaa
atttttggaaggaacagctgtctcatcgctagaaatcttttaagtggaatgaaaacatgt
atggaggtttttcagtacatgaattatgtggaagataaaagaacatatggagctgctgat
ggtgcaaattctctggttgaaggccatgccaaggttgactacaatgaatctatgggtaat
gaattgcagacaagatcaagattcttgagaagacgaggtagagttcgtcgcttgaaatac
acttggaaatctgctggttaccattccataagaaaaagaattacagagagaaaggatcaa
ccttatcggcagtataatccttgtggctgtcaatctgcttgtggaaagcaatgcccttgc
cttgtaaatggaacatgctgtgaaaaatattgcgggtgtcctaaaatttgtaagaaccga
tttcgaggttgtcattgtgccaagagccagtgtcgaagccgtcagtgcccatgctttgct
gctgatagggaatgtgaccctgatgtttgtagaaattgctgggttgggtgtggtgatggt
actttaggaggcccaaatcaaagaggagataattatgaatgccggaatatgaagcttctc
ctcaaacaacaacaaagggtcttacttggaagatctgatgtttctggctggggagcattc
cttaagaatagcgttggtaaacatgaataccttggggaatacaccggagaattaatctct
catcgagaagcagataagcgtggaaagatatatgaccgtgaaaattcatcatttcttttc
aaccttaatgatcagtttgttctcgatgcataccggaagggagataagttgaagtttgcc
aaccattcgcccgatccaaactgctatgccaaggtgatcatggtagcaggtgatcatagg
gtaggtatatttgccaaagaacggataagtgcaggggaagaactcttttatgactaccgt
tatgagccagaccgtgcacctgcttgggctcgaaaaccagaagcttcaggctcgaagaag
gatgaaatgcagccttctactggtcgagccaaaaagcttgcataa

DBGET integrated database retrieval system