KEGG   Phoenix dactylifera (date palm): 103713882Help
Entry
103713882         CDS       T03274                                 

Definition
(RefSeq) tetratricopeptide repeat protein SKI3 isoform X2
  KO
K12600  superkiller protein 3
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pda00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    103713882
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pda03019]
    103713882
Messenger RNA biogenesis [BR:pda03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Ski complex
     103713882
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_2 TPR_11 TPR_14 TPR_8 TPR_16 TPR_17 TPR_12 TPR_19 TPR_7 TPR_9 PRODH
Motif
Other DBs
NCBI-GeneID: 103713882
NCBI-ProteinID: XP_008799156
UniProt: A0A2H3ZU11
LinkDB All DBs
Position
Unknown
AA seq 1180 aa AA seqDB search
MEENLFRQLQQTLNDDPNNPTHHYSLGLFLWKKWERIDGEESKKYKEKSAEHFLACAKLN
PSEGAAFRFLGHYYSQVSADAQRASKCYQRAVTLNPDDFEAGEGLCDSLDEEGKESLEIA
LCKEASGKSPRAFWAYRRLGYLQVHQKKWSEAVQSLQHAIRGYPACADLWEALGLAYQCL
GMFTAAIKSYGRVIELDDSRVFALIESGNIQLMLGSFRKGVEQFQHALEITPHNVSAHFG
LASGLLAWSNDCINSGAFGWGASLLLEASEVAEASIRLSGNISSSWKLHGDIQITYAKCF
PWEDRRNSSEFDAEAFKASIVDWKKTCLLAANAAKQSYQRALHLSPWQANIYADIAISVD
LISSLEEKDTSDMDAWQLAERMSLGALILEGSNKDFWVILGCLSTNHALKQHALIRGLQL
DMSLSAAWAYLGKLYRTLGEKQLARKAFDHARSIDPSLALPWAGISVDSHGSSQSEAYEN
CLRAVQILPLPKFQVGLGALAIPSGQLLSPKVFGAIRQAIQRAPYSPEAHNLNGLLCEAR
SDYQSAITAYQQARCALHMEHNSVADLRSHIADVSVNLARALIKAGHANNAAEMCDYLKK
EGLFDSKGLQIYAVALWKIGQYDQALSMARNLAQSVSTMKQTCAAAALGLICSLIYRISG
RDSAVATIQKFPPELLQSTRMMFTLSALNALDPSNQLQLLLPSPQNVKSRDVVTEIYSII
AISKMIGHGLKQNLDIDGGVDYLRKALHLYPNSSLIRSQLSSLLLSSGDWMASHKAARCT
ATPNGHIVKKELELSYKIHGAAVVACYASCSNNPKFSFPTCKDQPAHGTNVIHSMQRWLH
QEPWNLDAHYLLVLNVLQKAREEKFPQHLCSTLKRLLLVALSKEIYMKENKLHQYQKFVL
LLCASEVSLQCGDYHGGVKHATDALGILPPNSDPFFAHLQLCRAYAAGEDFLNLKNEYMN
CLQIKTFNQIGWISLKYIESRYQLQNNSNAIDMYFHMCSTGKGASSNIWEAVFYLACAQS
YIWDQDYLRAEQALAHACAIRDAESCLLLFHGAVCMELARQQPGPQFLSRAVSSLTKAQE
TSPVPLPIVSLLLAQAEASLGAKAKWERNLRVEWFSWPAEMRPAELYFQMYLLARQSNAS
SSQHSGIESMQIPKNWVLQAVHLNPSCLRYWKVLQKLSEG
NT seq 3543 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaatctctttcggcaactgcagcaaaccctaaacgacgatccgaacaacccc
acccaccactacagtctcggtctcttcttgtggaaaaagtgggaaagaatagatggagag
gaatcgaagaaatacaaggagaagtcagctgagcatttcttggcctgtgcgaagctgaac
cccagtgaaggtgccgcgtttcggttcctagggcactactacagccaggtctcggcagac
gcacagagggcttccaagtgctaccagagggctgtgaccctgaatcccgatgattttgaa
gccggtgaagggctgtgtgattcgttggatgaagaaggaaaggaaagtttggagattgct
ttgtgtaaagaggcatctgggaagtccccgagagctttttgggcgtacaggagattagga
tacctgcaggtccaccaaaagaaatggtcagaggcagtacaaagccttcagcatgcaata
cggggatatccagcatgcgccgatttgtgggaagcacttggtcttgcataccaatgcttg
ggcatgtttactgcagcgataaagtcttacggacgagtcattgaattggatgactcaaga
gtatttgcactgatagaaagtgggaacattcagcttatgctcggttcatttagaaaagga
gttgagcaatttcagcatgctttagaaataacacctcataatgtatccgcacactttgga
cttgcttctgggctgcttgcttggtcgaatgattgcataaattctggagcatttggttgg
ggtgcttctctgttattggaagcatcagaagttgcagaagcgagtatccgtttatcagga
aatatatcttcttcttggaaattgcatggggatatccagatcacgtatgcaaaatgcttt
ccatgggaagatagaaggaatagtagtgaatttgatgcggaagcctttaaagcctccatc
gttgattggaagaagacatgccttttggctgcaaatgctgctaagcaatcataccaacgg
gctctacacttaagcccgtggcaggccaatatctatgctgatattgcaatctctgtggat
ctcatttcctccctggaagagaaagacacatcagacatggatgcttggcaactagcagag
aggatgtcattaggtgcgctgattctcgagggaagtaacaaggacttctgggttatattg
ggttgtttgtctacaaatcatgcattgaagcagcatgctcttattcgaggattgcagctg
gatatgtctctttctgcagcatgggcatacctggggaagctctatagaacattaggcgaa
aaacaattggcaaggaaagcatttgatcatgctagaagcattgatccttcactagcatta
ccatgggctggcatttcagttgactctcatggcagctcacaatccgaggcttatgaaaac
tgccttcgtgctgtgcagatactgcctctcccaaaatttcaagttggtcttggagcactt
gcaattccttctggtcaactactatctcctaaggtatttggagccatacgccaggctatt
cagcgagcgccttactctcctgaggcacataatttaaatggcttgctatgtgaagcacga
tcagattaccagtctgcgatcactgcctatcagcaagcacgatgtgctttgcatatggag
cacaattcagtggcagacctgagatctcatattgctgatgtgtcagttaatcttgccaga
gcactcattaaggcaggacatgcaaataatgctgcagaaatgtgtgattatttgaagaaa
gaaggtttgtttgatagcaagggcttgcaaatatatgctgttgcattgtggaaaattgga
cagtatgaccaagctctctccatggcaagaaatttggctcaaagtgtctcaaccatgaag
caaacatgtgcagctgctgcgctggggttgatatgcagtttgatatacagaatttcagga
agggattctgcagttgcaaccattcaaaaatttcctcctgaacttttacaaagtacaaga
atgatgtttacgctctctgcgctgaatgctctagacccaagcaatcaattgcagctgctt
cttccaagtcctcaaaatgttaaatctcgtgatgtggtcactgagatttactccataatt
gctatcagcaaaatgatcggccatggattaaaacaaaatttggatattgacggtggggtg
gattacctgagaaaagctcttcatttgtatcccaacagtagtttaataagaagccagctt
agttcacttctactatccagtggagattggatggcttcccacaaagcagctagatgcact
gccacaccgaatggacacattgttaagaaagaattagaattgtcatataaaattcatggt
gctgcagttgttgcttgctatgctagctgttccaacaatccaaagttttcttttccaacc
tgcaaagaccagcctgcacatggaacaaatgtcatacacagtatgcaaagatggttgcat
caagaaccgtggaacttggatgcacactaccttcttgtacttaatgttctacagaaagct
cgggaagaaaaatttcctcaacatctctgttctactttgaaacgtctacttttagttgct
ctgtccaaagaaatatatatgaaggaaaataaactacatcagtatcaaaagtttgtgctt
ctgctctgtgcttcagaggtcagtttgcagtgtggtgactatcatggtggtgtcaagcat
gctactgatgcattaggaattcttcctcccaacagtgatcccttttttgcacacttacaa
ttgtgtcgtgcttatgcagcaggagaggattttttgaaccttaaaaatgagtacatgaat
tgcttgcagattaagacatttaatcaaattggttggatatcactaaaatatattgaatcc
agataccaattgcaaaacaattcaaatgcaatagatatgtactttcatatgtgctccaca
gggaaaggggcttcctcaaatatatgggaggctgtcttttatttagcctgtgctcaatcc
tatatatgggatcaggattacttacgtgcggaacaagctttagcacatgcctgtgcaatc
agagatgcggagagctgcctcttactctttcatggtgccgtctgcatggagcttgctagg
caacaaccaggtcctcaatttttatcccgtgcagtaagcagcctcaccaaggcccaggag
acctcacctgttcctttacctattgtttccttgttgttggctcaagcagaagctagcctt
ggtgcaaaagctaagtgggagaggaaccttcgagtcgaatggttctcttggccagcagaa
atgaggcctgctgagttgtatttccaaatgtacttgcttgcaaggcagtcgaatgcaagc
tccagccaacattctggcatagaatccatgcaaatcccaaagaattgggttcttcaagca
gtacatttgaatccatcttgtctgagatactggaaggttttgcagaagctttctgaggga
tag

DBGET integrated database retrieval system