KEGG   Phoenix dactylifera (date palm): 103721532Help
Entry
103721532         CDS       T03274                                 

Definition
(RefSeq) beta-galactosidase 8
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00052  Galactose metabolism
pda00511  Other glycan degradation
pda00531  Glycosaminoglycan degradation
pda00600  Sphingolipid metabolism
pda00604  Glycosphingolipid biosynthesis - ganglio series
pda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103721532
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    103721532
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    103721532
   00604 Glycosphingolipid biosynthesis - ganglio series
    103721532
   00511 Other glycan degradation
    103721532
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pda04147]
    103721532
Enzymes [BR:pda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     103721532
Exosome [BR:pda04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103721532
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 103721532
NCBI-ProteinID: XP_008810021
UniProt: A0A2H3Z8H9
LinkDB All DBs
Position
Unknown
AA seq 648 aa AA seqDB search
MPKNGYKMFILIITPFFWFPVLYLCAVHAFYVQYWEDRLLRAKALGLNTIQTYVPWNLHE
PEPQKWVFEGIADIESFLKLAQELGFLVMLRAGPYICAEWDFGGFPAWLLAIEPALKLRS
SDPEFLQLVERWWGVLLPKMSPLLYENGGPIIMVQVENEFGSYGDDKKYLHHLVTLARRH
LGNDIVLYTTDGGSKDALEKGTIPEEGVFSAVDFSTGDNPWPIFKLQKKYNAPGKSPALS
SEFYTGWLTHWGEQIAETGASFTAAALQTILSRNGSAVLYMAHGGTNFEFFNGANTGQNE
SDYKADLTSYDYDAPIKESGDVDNPKFKALRRVIEKYSSVALPPVPSNNKRASYGLFKVS
KIASFFEVLDTICSPMEVVEAEHPLAMESVGQMFGFVLYVTEYSQKETSSILSIPKVRDR
AQVFVSCSIDDKGSPRYVGVIERWSNKALAMPKITCSSNISLFVLVENLGRVNYGPYMYD
RKGILSPVILDNIVLHRWKMHPISFQRFINHSKDNPIMQVANSRINKISIQNSLKDHSSR
FSFSLKESISEEPGFYKGHFYINSINQVRDTFISFRGWSKGVAFVNNFNIGRFWPLFGPQ
CTLYVPAPILQHGENVVVILELHAPNPDLTIELVENPDFTCGPKLHHK
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaaaatggatataagatgtttattttaattattactccttttttttggtttcct
gtgctatatttatgtgcagtacatgctttctatgtgcagtactgggaagatagactttta
agagccaaggcactcggcttgaacaccatccaaacctacgttccttggaatttacatgaa
ccagaaccccagaaatgggtttttgagggtattgcagatatcgaatcgtttttgaagctt
gcacaagaattaggttttcttgtcatgctacgtgcaggaccctacatctgtgcagagtgg
gactttggaggttttcctgcgtggttgctagctatagaaccagctctcaaactgagatca
tcagatcctgaattccttcagttggtcgaaagatggtggggagttttgcttccaaaaatg
tctcctctactgtatgagaatgggggtcctattattatggttcaggtagaaaatgagttt
ggatcatatggggatgacaagaaatatctccatcacctagtgactttggccagaaggcac
cttgggaatgatattgttctgtatactacggatggtggctctaaagatgcactagaaaag
ggaactattcctgaggagggtgttttctcagctgttgatttttcaactggtgacaatcca
tggccaatatttaagttgcagaagaagtacaatgcaccaggaaaatcgcctgctctatca
tcggaattttatacaggatggcttacacattggggagagcagattgcagaaactggtgcc
agctttacagctgcagccctgcaaacgattttatctcgaaatggttctgcagtactctat
atggctcatggtggaaccaattttgagtttttcaatggtgcaaatactggtcagaatgaa
tctgattacaaggctgacctcacttcttatgattatgatgctccaatcaaggagtctggt
gatgtggacaacccaaagttcaaagcgttaagaagagtcattgagaaatatagcagcgta
gctcttcccccagttccttccaataataagagggcaagttatgggctttttaaggttagc
aaaattgcttccttctttgaggtccttgataccatatgttctccaatggaggtggttgaa
gcagaacatccccttgcaatggagtcggtaggccagatgtttggatttgtattatatgtg
acagaatactcccaaaaggaaacaagtagtattctttcaattcccaaggtgcgtgacaga
gcccaagtgtttgtttcatgctcaattgatgataagggaagtccaagatatgttggtgta
attgaaagatggtcaaacaaggcacttgcaatgcccaaaatcacttgctcttctaacatc
agcttatttgttctggtggaaaatttgggtcgtgtaaattatgggccatacatgtatgac
aggaagggaatactgtccccagttatactggacaacatcgttctccatcggtggaaaatg
catccaatctcatttcagagatttattaatcattcaaaagataatcctatcatgcaagtt
gccaattctagaattaataagatatcgatccagaatagtctgaaagatcactccagcagg
ttctcattttcacttaaagagagtatttcagaggaaccaggattttacaaaggtcatttc
tatataaattcaataaaccaagttagagatacattcatatcatttcgtggttggagcaaa
ggggttgcttttgtgaacaatttcaatattgggagattttggccgttgtttggacctcag
tgcaccctttatgttcctgcaccaatccttcaacatggagaaaatgttgtggtcatacta
gagttacatgctcccaatcctgatctcactatcgagttggtggaaaatccagattttaca
tgtggaccaaaacttcatcataaatga

DBGET integrated database retrieval system