KEGG   Phoenix dactylifera (date palm): 103723066Help
Entry
103723066         CDS       T03274                                 

Definition
(RefSeq) uncharacterized LOC103723066
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00620  Pyruvate metabolism
pda00710  Carbon fixation in photosynthetic organisms
pda01100  Metabolic pathways
pda01200  Carbon metabolism
Module
pda_M00168  CAM (Crassulacean acid metabolism), dark
pda_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
pda_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
pda_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:pda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    103723066
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    103723066
Enzymes [BR:pda01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     103723066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 103723066
NCBI-ProteinID: XP_017702142
UniProt: A0A2H4A0B6
LinkDB All DBs
Position
Un
AA seq 2346 aa AA seqDB search
MPLVRFEVRNEYRLGDPELYRGPAKKEDSKVLLDGVAVAGLVGILRQLGDLAEFAADVFH
DLHEQVTTTAARGRKMLTRVKNIEGALPSLEKAIHGQTSHIHFAYVAGCVWHADLQNQQS
RLLSNELPCFMMDFYEECRDPPRLYLLDKYDSAGAGACLKKYSDPSYFKRVWTLSESEKG
EHAQKEKKAQKIKRKGSRLRNGEVHAAHISRHNSCLASSSPFASPSTDARSFSSQNLSTP
DMRLNPELASESRMSFGSKIWSSCVKEVLDTSRSVVSDDQEYDRVSDSKLDMKHSGSCAS
VLHDEPNGDVGEDNSQHDSLQGQSIDRYSSVTWDEKTEIVKAASPISCDDIIVDKVQDSE
SLPVNSEPPKVDHTKVRVSDQEDILFDIAKVSVSLSGANRIDEITSETDNYMDALNTLES
ETETEAECQTKREVNSVCNSSSQGMESGTREMLETAGKIPDSHDNEALNASDGLLSQDLS
PKFSNLVSSDCLDSMQSPHMTDSPSTSKCSVDNDFSENNVHDIMRMNVYEGIDGDPSADS
SIPSLQTRLGSEAPVETSISQHSPSVDTADVSSIKLWTNAGLFGVEPSKPPDLGVPNIAS
ENIVSDPKSYACDLSSYTGKTKLHASGLASKSDTKDMPNEIISNVFGSMDKMAGTLRTSN
SSVQCNLSGDQLFVRTYDVVQQNDPSNCSPSFNTHEHEGRPVKQISPCSPSFTSIHAHSD
EPVVTRNNGVAPKAELSAAHNIESQCSEAGPSTNIMSSSFTGLAQRFLVNTLQRKASPIY
ADIPMPTGVTNAEQRKSDESCLANNHKKVPTGVVSQESNEESTKEKIGNGSLKKSLSSTS
HYSEQSSPPLEHMKISFQPLNGLDSRLKLEFPNGNLHESIEDLMFPSFQLLPRSSVPLPD
SGSDSDDDTFCRSCPYSSEDPLSPRSYSNSELWEQEVRNGCEDHEIYGDSQAISSSTASL
SSYMGFEQLNHSSIDTVGRYVYLEAEKGTGSFQSGSIVDLPGLESVISLKNQQGRDDPVT
STLQSQDQLPPPPPLPPMQWRIMKTLIASGEDRDANTADSVNQLGGLQTPKLASQQQVQS
APKKPPHISAQDQQKLNGHKESNHVANNKELDLRGELLHQIRNKHDQQKLNGHEKLENES
TSNKEEMLHQIRNKTFNLKRATTSKPTNVPQPTTNVNVAAILEKANAIRQAFVGSDEGGD
DDNWSDGCHKEEECQFFVPAMEGEDHGRVRVLPTPMVVETDPEKATSMEEKGAKLMGKPM
FESWLATTKIRQPNPMRSGVRLRKTIESGSESTFGPGSSHSSPSSPRNLSSSLSSPPDLD
GWRLSGGKSSGCNGFWREIRRQRNKIRSIRDNDSQMIEDARSICRKLLQRGSERGGERER
EMSKNSLERHASMDAKLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGEEIRETVQE
CYELSAEYERKQDPKKLDELGNVLTSLDPGDSIVVSSSFSHMLNLANLAEEVQIAHRRRI
KRKKGDFADENSATTESDIEETFKRLVVQLKKSPQEVFDALKNQTVDLVFTAHPTQSVRR
SLLQKHARIRNCLEQLNAKDITPDEKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG
MSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARMMAANLYFSQIEDLMFELSMWRCSDELRVRAIELHQSSKKDSKHYIEFWKQI
PPNEPYRVILGDVRDKLYNTRERSRQLLSSGYSDIPEEASFTNIEQFLEPLELCYRSLCS
CGDKPIADGSLLDFLRQVSTFGLSFVRLDIRQESDRHTDVIDAITRHLGIGSYRDWPEEQ
RQEWLLSELRGKRPLFGPDLPQTEEIADVLDTFHVIAELPADNFGAYIISMATAPSDVLA
VELLQRECHVKKPLRVVPLFEKLADLEAAPAALARLFSIDWYRNRIDGKQEVMIGYSDSG
KDAGRLSAAWQLYKAQEELIKVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIH
GSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMRPPISPKPEWRALMDEMAVVAT
KEYRSIVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTR
FHLPVWLGFGAAFKLTMEKDIRNLHTLREMYNEWPFFRVTIDLVEMVFAKGDPGIAALYD
KLLVSEDLWPFGERLRTNYEETKRLLLEVAGHKDLLEGDPYLKQRLCLRDSYITTLNVCQ
ACTLKQIRDPSFHVKVGPHLSKEVMDSSKPAAELVKLNPTSDYAPGLEDTLILTMKGIAA
GMQNTG
NT seq 7041 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcgtgcggttcgaggtgaggaatgaataccggctgggagatccggagctctac
cgggggccggccaagaaggaggactccaaggttctcttggatggggttgcggtcgcgggg
ctcgttgggatcttgaggcagctgggcgatctcgccgagtttgctgcggatgttttccat
gacctgcatgaacaagtgacaacgacagctgcaagggggcgtaaaatgttgactcgagta
aagaacatagaaggagcacttccatcacttgagaaggccattcatggtcaaacaagccat
atacattttgcttatgtagcaggttgtgtctggcatgccgatctccaaaaccagcagagt
cgcctcctatctaatgaattgccatgctttatgatggatttctatgaagaatgtcgtgat
ccaccacgtttgtacctgcttgacaaatatgatagtgctggtgctggagcttgtttaaag
aaatattcagatccatcctactttaagagagtttggactttgtcagaatcagagaaaggt
gaacatgcacagaaagaaaagaaagctcagaagatcaagagaaaaggatcgcgtctgagg
aatggagaagttcatgcagcacacatatcgcggcacaatagctgcctagctagcagctca
ccttttgcatctccaagcactgatgcacgaagcttttcaagccagaatttatcgacacct
gatatgagattaaatcctgaacttgctagtgaatcaagaatgtcttttggttcaaagatt
tggtcgagctgtgttaaagaagttttggatacaagccgttcagtggtgtctgatgaccaa
gaatatgatagagtttctgattctaagttagatatgaaacacagtggttcttgtgcttct
gttttacatgatgaacctaatggagatgttggagaagataattctcaacatgattctttg
caagggcaaagcattgacagatactcttctgttacttgggatgaaaaaactgaaattgtt
aaggctgcaagtcccatatcatgtgatgacataattgtggataaggtccaagattcagag
tctctgccagtaaactctgagccaccaaaagtggatcataccaaagttagagtctcagat
caagaggacattttgtttgatattgctaaagtatcagtatcattatctggtgcaaaccgc
attgatgaaatcacaagtgagacagacaactatatggatgcactcaatacactagaatct
gagacagagacagaagcagagtgccaaaccaaacgggaagtgaactcagtgtgtaactct
agttctcaaggaatggaatctggaactagagagatgctggagacagcggggaaaattcct
gattcccatgataatgaagctctgaatgcatctgatgggctcttgagccaagatctgtct
ccaaaattttcaaacttagtatcttcagattgtctggacagtatgcagtcacctcacatg
actgactcgccttcaacctcaaagtgctctgttgacaatgatttttctgaaaataatgtt
catgatattatgagaatgaatgtctatgaaggcattgatggtgatccatctgctgattca
agcattcctagtttgcaaaccaggttgggcagtgaagctcctgttgaaacatccatctct
caacattctccttctgttgatactgctgacgtgtcttccattaaactctggacaaatgct
gggctttttggagttgagccttcaaaacctccagaccttggtgttccaaatattgcaagc
gagaatattgtatctgatcctaaaagttatgcatgtgatctttcaagctacacagggaag
actaagttgcatgctagtggattagcttccaaatcagacactaaagatatgccgaatgaa
atcatatcaaatgtttttggctctatggacaaaatggctgggacactacgtacttcgaat
tcctcagtccagtgtaatttaagtggtgatcaattgtttgtcagaacatatgatgtggtg
caacagaatgatccatccaattgttccccatctttcaacacacatgaacatgagggtagg
cctgtcaagcagatatcaccttgttccccatcttttactagcattcatgctcactctgat
gaacctgttgtaacaagaaacaatggtgttgctcctaaagctgaactatcagctgctcat
aatattgagtcacaatgcagtgaagctggcccaagcacaaacattatgtcatccagtttt
actggccttgcacagagatttcttgtaaatactcttcaaagaaaagcatcacctatatat
gctgatattcctatgccgactggagtgacgaatgctgaacaaaggaagtcagatgagagc
tgccttgcgaataaccacaagaaggtaccaactggagttgtatctcaggagtccaatgaa
gagagtaccaaagaaaagattggcaatggatcattaaaaaagtctctctcttctacttca
cattactcagagcaatcctctccgccacttgaacacatgaagatctcttttcagcctttg
aatggcttggactccagattgaaactggaatttcccaatggcaatctccatgaaagcatt
gaagatttgatgtttccatcatttcaattgcttccaaggtccagtgttcctttgccagac
agtggctctgattcagatgatgacacattctgtagatcttgtccatattcttctgaggat
cctctcagccctcgctcgtattcgaactctgagctatgggaacaagaggtaagaaatgga
tgtgaagaccatgagatatatggtgattcacaagcaatttcatcttcaacagcatccctc
tctagctacatgggatttgagcaattgaaccattccagcatagatacagtcggcagatat
gtgtatttggaggctgagaaaggcacagggtcttttcaatctggttcgatagtggacctc
ccaggtcttgaatctgttatctctttgaaaaatcaacaaggaagagatgatccagtgaca
tctacattgcaatcccaagatcagctgccaccaccgccacctctccctccaatgcagtgg
agaataatgaagacattaattgcttcaggagaggatagggatgctaatactgctgacagt
gttaaccagttgggtggtctacaaactccaaaacttgcttctcagcagcaagtacaaagt
gctccaaaaaagccaccacatatttctgcgcaagatcagcagaagctgaacgggcacaaa
gagtcaaatcatgttgctaataacaaggaattggatttaagaggagagttgctccatcaa
atcaggaacaagcatgatcagcagaaactaaatggacacgaaaaactggaaaatgagagt
actagcaataaggaagagatgcttcatcagataaggaacaagacatttaatctgaagcgt
gccacaacatcaaagccaactaatgttccacaacctaccaccaatgtcaatgttgctgca
atcttggagaaggcaaatgcaattcgccaggcatttgtgggtagtgacgagggtggtgat
gatgataactggagtgatgggtgtcacaaagaagaggaatgtcagttctttgtgccggcg
atggagggggaagaccatgggcgagttagggttttgccgactcctatggtggtggagacg
gatccggagaaagcgacatcgatggaggagaaaggtgcaaagctgatggggaagcctatg
ttcgaatcgtggcttgcaacgaccaagattcggcaacctaacccgatgaggagcggggtg
cggctgaggaagacgattgagtctggctcggagtccacctttggcccgggctcgtcccac
tctagcccaagttcgccaaggaacctgtcgagctcgctcagctcaccaccagatttggat
ggctggagactttctggcggcaaaagttcaggatgcaatggattctggagggagataaga
agacagaggaacaaaattcggagcatcagagacaatgatagccagatgatagaggatgca
aggagtatctgccggaagcttcttcagcgagggagcgagagaggtggggagagggagaga
gagatgtcgaagaattcgctggagaggcatgcgtcgatggacgcgaagctgaggcttctg
gccccggggaaggtgtcggaggacgacaagctggtggaatacgacgccctgctcctggat
cgctttcttgacatcctccaggacttgcacggcgaggagatcagagaaacggttcaagag
tgctatgaactttctgccgagtatgagcggaagcaggatccaaagaagctggatgagctg
gggaatgtgctcacgagtctggatcctggggattctattgtggtttccagttcattttcc
cacatgcttaacttggccaacttggctgaggaggtccagatcgcccatcggcggaggatc
aagcggaagaagggagattttgctgatgagaattccgcaaccaccgagtcggacattgag
gaaacttttaaaagacttgttgtgcagctgaagaagtcacctcaggaggtctttgatgct
ctcaagaaccagacagttgatctggttttcactgcacacccaactcaatcggtccgccga
tcactgcttcagaagcatgcaaggataagaaattgtttggaacagcttaatgccaaggac
attactcccgatgagaagcaggagcttgatgaagctcttcagagagagattcaagctgcc
tttagaactgatgaaatccgaaggacgccacccactccacaggatgaaatgcgggcaggg
atgagttattttcacgaaacaatctggaagggtgtcccaaaattcttgcgtcgtgttgat
acggctctgaagaacattgggatcaatgagcgtgttccttacaatgctcctcttattcaa
ttttcttcttggatgggtggggatcgtgatggaaatcctagagttactccggaggttaca
agggatgtatgcttattggctagaatgatggctgcgaacttgtacttctcccagattgaa
gatctaatgtttgagctgtcaatgtggcgctgcagtgatgaactacgagttcgggctatt
gaactgcaccagtcctcaaaaaaagattcgaaacactatatagagttttggaagcaaatt
cctccaaatgaaccttatcgtgttatacttggtgatgtgagggataaactatataataca
cgtgagcgttctcgtcagctattgtcaagtggatattctgacattcccgaggaagcatcc
tttaccaatattgagcagtttctggaaccccttgaactctgttacagatcactttgctct
tgtggcgacaaacctattgctgatggaagtcttcttgacttcttgcgccaagtatcaacc
tttggcctttcttttgtgagactagatatcaggcaagaatctgataggcacactgatgtc
attgatgctattactaggcatcttggtattggatcataccgtgattggcctgaggaacaa
cgtcaggagtggctgttgtctgagcttagaggcaagcgccctctatttggtcctgacctt
ccccaaactgaggaaattgctgatgttctagatacattccatgtcatagcggaacttcct
gctgacaactttggggcctatatcatctcaatggcaactgctccatcagatgtgcttgca
gttgagctcttgcagcgtgagtgccatgtgaagaagccgttgagagttgtgccattgttt
gagaagctagcagatcttgaggcagcacctgcagctttagcccgcctcttctcaatagac
tggtacagaaataggattgatggcaagcaggaggtaatgattgggtattcagattctggg
aaggatgctggtcgtctttctgcagcttggcaattatataaagctcaagaggagcttata
aaagtcgctaagcaatatggagtgaagttgacaatgtttcatggacgaggggggacagtt
gggagaggaggcggtcctactcatcttgctatattgtctcagccgccagacactattcat
ggatcgcttcgtgtgacagttcaaggtgaagtcattgagcaatcttttggagaggaacat
ctatgctttagaacactccaacgtttcacagctgctacccttgaacatggcatgcgtcct
ccaatttctccaaagccagaatggcgtgctctgatggatgagatggctgtggtggccacg
aaggaatatcgctcaatcgtcttccaagaaccacgctttgttgaatacttccgcctggca
acacctgagctggaatatggcaggatgaatatcggcagcaggccatcaaaaaggaaacct
agtgggggcatagaatcactccgtgcaataccgtggatttttgcttggacccagacaagg
tttcaccttcctgtgtggcttggatttggtgcagcattcaagcttaccatggaaaaggat
atcagaaatcttcatacactgcgagaaatgtacaatgaatggccatttttcagggtcaca
atagacttggtggagatggtttttgctaagggagatccgggcattgctgctttatacgac
aaattgcttgtgtctgaagatttatggccatttggggagcgactgagaaccaactatgaa
gagacaaaacgccttcttcttgaggttgctggccacaaggatcttcttgaaggcgatcct
tacttgaagcagagattatgtctccgtgattcttacataaccactctaaatgtttgtcaa
gcttgtacactgaagcagatcagggaccccagtttccatgtcaaggtggggccacatttg
tcgaaggaggtcatggattctagcaaaccagctgctgaattagtgaagttgaatcccacg
agcgattacgcccctgggctggaagacacccttatcttgaccatgaagggtattgctgct
ggcatgcagaacaccggttag

DBGET integrated database retrieval system