KEGG   Phoenix dactylifera (date palm): 8890518Help
Entry
8890518           CDS       T03274                                 

Gene name
rbcL, PhdaC_p029
Definition
(RefSeq) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
pda00630  Glyoxylate and dicarboxylate metabolism
pda00710  Carbon fixation in photosynthetic organisms
pda01100  Metabolic pathways
pda01200  Carbon metabolism
Module
pda_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pda_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pda_M00532  Photorespiration
pda_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pda00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    8890518 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    8890518 (rbcL)
Enzymes [BR:pda01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     8890518 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 8890518
NCBI-ProteinID: YP_003540939
UniProt: D4PBB9
LinkDB All DBs
Position
CP
AA seq 484 aa AA seqDB search
MSCREGLMSPQTETKASVGFKAGVKDYKLTYYTPDYETKDTDILAAFRVTPQPGVPPEEA
GAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIETVVGEENQYIAYVAYPLDLFEEGSV
TNMFTSIVGNVFGFKALRALRLEDLRIPTSYSKTFQGPPHGIQVERDKLNKYGRPLLGCT
IKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFVFCAEALYKAQAETG
EIKGHYLNATAGTCEEMMKRAMCARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHI
HRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGEREMTLGFVDLLRDDF
IEKDRSRGIFFTQDWVSMPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGN
APGAVANRVALEACVQARNEGRDLAREGNEIIREASKWSPELAAACEVWKAIKFEFEPVD
KLDK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtagggagggacttatgtcaccacaaacagagactaaagcaagtgttggattt
aaagctggtgttaaagattacaaattgacttattatactcctgactacgaaaccaaagat
actgatatcttggcagcattccgagtaactcctcaacccggagttccgcctgaggaagca
ggggcagcggtagctgccgaatcttctactggtacatggacaactgtgtggactgatgga
cttaccagtcttgatcgttacaaaggacgatgctaccacatcgaaaccgttgtaggggag
gaaaatcaatatattgcttatgtagcttatcctttagacctttttgaagaaggttctgtt
actaacatgtttacttccattgtgggtaatgtatttggtttcaaagccctacgagctcta
cgtctggaggatctgcgaattcccacttcttattccaaaactttccaaggcccgcctcat
ggcatccaagttgaaagagataagttgaacaagtatggtcggcctctattgggatgtact
attaaaccaaaattgggattatccgcaaagaactacggtagagcggtttatgaatgtcta
cgcggtggacttgattttaccaaggatgatgaaaacgtgaactcacaaccatttatgcgt
tggagagaccgtttcgtattttgtgccgaagcgctttataaagcgcaggccgaaacgggt
gaaatcaaaggacattacttgaatgctactgcaggtacatgtgaagaaatgatgaaaagg
gccatgtgtgccagagaattgggagttcctatcgtaatgcatgactacttaactggagga
ttcactgcaaatactagcttggctcattattgccgcgataacggcctacttcttcacatc
catcgcgcaatgcatgcagttattgatagacagaaaaatcatggtatgcattttcgtgta
ctagctaaagcattacgtatgtctggtggagatcatattcacgcgggtacagtagtgggt
aaactggaaggggaacgtgagatgactttgggttttgttgatttattacgtgatgatttt
attgaaaaagaccgaagtcgcggtatcttttttactcaagattgggtctctatgccaggt
gttttgcccgtggcttcagggggtattcatgtttggcatatgcctgccctgaccgaaatc
tttggggatgattccgtactacagtttggcggaggaactttaggacacccttggggaaat
gcacccggtgcagtagctaatcgggtggctttagaagcgtgtgtacaagctcgtaatgag
ggacgtgatcttgctcgtgaaggtaatgaaattatccgtgaagctagcaaatggagccct
gaactagctgccgcttgtgaagtatggaaggcgatcaaattcgaattcgaaccagtggat
aagctggataaatag

DBGET integrated database retrieval system