KEGG   Pocillopora damicornis (lace coral): 113664928
Entry
113664928         CDS       T05773                                 

Definition
(RefSeq) stress-activated protein kinase JNK-like isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04068  FoxO signaling pathway
pdam04137  Mitophagy - animal
pdam04140  Autophagy - animal
pdam04141  Protein processing in endoplasmic reticulum
pdam04215  Apoptosis - multiple species
pdam04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113664928
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    113664928
   04068 FoxO signaling pathway
    113664928
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113664928
   04137 Mitophagy - animal
    113664928
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113664928
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pdam01001]
    113664928
Enzymes [BR:pdam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     113664928
Protein kinases [BR:pdam01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   113664928
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo ABC1 Kinase-like APH RIO1
Other DBs
NCBI-GeneID: 113664928
NCBI-ProteinID: XP_027036351
LinkDB
Position
Unknown
AA seq 452 aa
MFKCCGVVPLLWKTLDKVVVGEKSDGGLRDILNLSADMYYSVQVGDTVFTVLKRYRNLQI
IGSGAQGMVCSALDSTTGEKVAIKKLSRPFQNVTHAKRAFRELVLLKMVNHKNIIGLLNV
FTPDRSYEEFQDLYLVTELMDASLVQVIQMDLDHERLSYLMYQMLCGVKHLHDAGIIHRD
LKPSNIVVKSDCSLKILDFGLARTAGAAFMMTPYVVTRYYRAPEVILGMGYSENVDVWSV
GCILGEMIRGSVMFPGTDHIDQWNKVTELLGTPSESFLSQLQPSVRMYCSSRPKQPGFSF
DDLFPDDLFPPGNKTKANECRDLLSKMLVVDRSKRISVIEALHHPYIHVWYERSEVESTI
PNKYDHSVDEKELTVEDWKRTIYQEVISYNNTNDTPPVVEGNGEINASSSSSSISSGIES
SKKKAKRKKREVQTGGGTLGSRIRQMIRGDEY
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgtttaagtgttgtggagtcgttcctttactttggaaaactttagataaggttgtcgtg
ggagagaaaagtgatggtggattgagagacattcttaatctatctgcggacatgtattat
tccgtgcaagtcggtgataccgtttttactgtgttgaaacggtaccgcaatcttcagatt
attggttctggagcgcaaggaatggtgtgctcagcgttagactctaccacaggagagaag
gttgctatcaaaaaactgagccgaccatttcaaaatgtcacacatgccaagagagctttc
cgagaactggtactgttgaagatggtcaaccacaagaatataattggtctcctgaatgtt
ttcaccccagacagatcatatgaagagtttcaggacctatatttagtgacagaattgatg
gatgccagtcttgtccaagtcattcaaatggatttggatcatgaaaggctttcatatctt
atgtaccagatgctgtgtggcgtaaagcacctacatgatgcaggcatcattcacagggac
ctcaagccaagtaacattgtcgtcaagtcagattgttcactgaagatacttgactttgga
ctggcacgtactgctggtgcagcattcatgatgacgccatatgtagtgacacggtactac
agggctccagaagttatcttaggcatgggttacagtgagaatgtggatgtgtggtctgtt
ggctgtatactgggtgagatgatccgtggaagtgttatgtttcctggaactgatcacatt
gatcagtggaataaggttactgagcttcttggcacaccgtcagagtccttcctcagccag
ctacaaccatcagtgagaatgtactgttcaagtcgtcctaagcagccaggattcagtttt
gatgatcttttcccagatgatttgtttccacctgggaacaagactaaagccaatgaatgt
cgcgatcttttgtcaaagatgcttgtagttgacaggtcaaagcggatatcagtcattgaa
gccttgcaccatccttatattcatgtttggtacgagagaagcgaagtggaatcgacaata
cccaataaatatgatcattcggtggatgagaaggaactaacagttgaagactggaaacga
acaatttaccaggaagtaatttcttacaataacacgaacgacactccaccagttgtggag
ggaaatggggagatcaacgcttcatcatccagttctagtatttcatcaggaatagaaagt
tccaaaaagaaagcgaaacgtaaaaaacgagaggtacagacaggaggtggaactttaggc
tcaagaatcagacagatgataagaggagatgaatactaa

DBGET integrated database retrieval system