KEGG   Pocillopora damicornis (lace coral): 113666028
Entry
113666028         CDS       T05773                                 

Definition
(RefSeq) caspase-3-like
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113666028
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pdam01002]
    113666028
Enzymes [BR:pdam01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     113666028
Peptidases and inhibitors [BR:pdam01002]
 Cysteine peptidases
  Family C14: caspase family
   113666028
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 113666028
NCBI-ProteinID: XP_027037576
LinkDB
Position
Unknown
AA seq 393 aa
MQDSEREALRKNRQALLKDLEAKKIASRLFSSNIFSVEDKDEVNSKETKNDQGEALLDIL
PRKGPKAFKAFCDALHDVSPHLESLLRPIQAEGMPTEGTDGGISTKKPIPSTINPGAAEH
ADQADAKLFSFGGSSGSKPSSNTLDTETVYKMDQGTRGIAIIINNKEFLRSSGMDRYPRN
GTDVDRDGLSKLFRMLKFEVRVYNNRTKAEIRNTAKEMANYNHSNYNAFIFSILTHGEEG
VIYGTDGTLTIKEITSEFKYSASLAGKPKLFFFQACQGHEYMDGMDVTDAPQDNRVSVPA
EADFLYAYSTVPGYYSWRNSVNGSWFIQSLTKVFEDNAERMDILRMLTRVNAMVSTYKSR
TGDYYSDSKRQVSSIVSMLRKELYFFPENIERS
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcaagattcagagagagaagcacttcgtaaaaacaggcaggctttgttaaaggattta
gaggcaaaaaagatcgcgtctcggcttttttcctctaacattttcagtgtagaagacaaa
gacgaagtcaactccaaagaaaccaagaacgatcaaggagaggctttattagacattctt
cctcgtaaaggaccaaaagctttcaaggcattctgtgacgctttgcacgatgtctctcct
catttggagtcacttctaaggccaattcaagcagagggtatgccaactgaaggtactgat
ggtggaatcagcaccaagaaacctattccaagcactatcaatccaggagcagcagaacat
gcagatcaagctgatgctaaattgttttcatttggaggcagctctggttccaaaccctcc
tccaatactttggacacggagactgtatacaagatggaccaaggaacgcggggaattgcc
atcatcattaacaacaaggagttcctgaggagttcaggaatggatcggtatcctcgcaat
ggaacagacgtcgatcgagatggtttgagtaagcttttcagaatgcttaagtttgaagtg
agggtttacaataatcgtaccaaggctgagatacgtaacactgcaaaggagatggcgaat
tacaaccattccaactacaatgcctttattttctcgatccttactcacggtgaagagggt
gtgatttatggtacagacgggacccttaccatcaaggaaatcacatcagagttcaaatat
tctgcatctttggccgggaagcctaaactctttttcttccaagcttgtcaaggccacgag
tacatggacggtatggacgtaacagacgccccgcaagataatcgagtctctgtcccagct
gaggcagacttcctttatgcctactccactgtgcccggttactactcatggaggaactct
gtcaatggatcgtggttcattcagtcgctgacaaaggtgtttgaagataacgcggagcgc
atggatatcctccgcatgctgacccgtgtcaacgccatggtgtccacctacaagtcgcga
actggcgactattactctgacagcaagcgccaggtttctagtattgtttccatgttgcgc
aaggaactgtatttcttccctgaaaacatcgagcgcagttaa

KEGG   Pocillopora damicornis (lace coral): 113679245
Entry
113679245         CDS       T05773                                 

Definition
(RefSeq) caspase-3-like
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113679245
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pdam01002]
    113679245
Enzymes [BR:pdam01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     113679245
Peptidases and inhibitors [BR:pdam01002]
 Cysteine peptidases
  Family C14: caspase family
   113679245
SSDB
Motif
Pfam: Peptidase_C14 UPF0180
Other DBs
NCBI-GeneID: 113679245
NCBI-ProteinID: XP_027051996
LinkDB
Position
Unknown
AA seq 322 aa
MGNVLFNYLGNGVSEDLREEIARHGKAYDADDSIQLTPTLQMADTSRNVNRVKDLPKDQV
YEGVQNPYVLVINNVNFKEDPVPRNGAEHDLENVETFLREAGFESVEKRYDLEKKEMMAA
FDETRKSIESGKHDGLICIIMSHGDDRGIKCKNGETIPVDEITSKFRGSDESCPQLAGKP
KLFFLQACRGIVDDRGYQHAASWQDDDVVADSFSSERTSLTLPSDADFLISYSTTTGYKS
YRRFTMPTAGAPPSETLGSWFIFTLMRVLRENSHKDDLMTMLTKVNQEMIKYATGKGCKQ
IPSHVSMLTRKVFFTNFFNKTF
NT seq 969 nt   +upstreamnt  +downstreamnt
atgggcaacgttttgtttaactatttaggtaacggtgtgagcgaagatctccgggaggaa
atcgcccgtcacggcaaggcgtatgatgccgatgattcgattcagttgacacccactctt
caaatggcagatacgagtcgaaacgtcaatcgtgtaaaagacctgccaaaggatcaagtc
tacgaaggggtgcagaatccgtatgtgttagtgataaacaacgtgaactttaaagaagac
ccagtaccaaggaatggagccgaacacgatcttgaaaacgtggaaacgtttttacgagaa
gctggtttcgagtctgtggagaagcgttacgatctggaaaaaaaagagatgatggcagct
tttgacgaaactcgaaaaagtattgaatcaggtaaacatgacggcctcatatgcattatc
atgagtcacggcgatgacagaggaatcaagtgcaagaacggtgaaaccattccagttgac
gaaataacctctaaattccgtggtagcgatgaatcatgtccacagctagcgggaaaacct
aaactattcttccttcaagcatgcagaggaatagtcgacgatagagggtatcagcatgca
gccagttggcaagacgacgatgttgttgctgatagcttttcttctgagagaacgtctctg
acgcttccttctgatgcagattttttgattagttactctaccaccacgggttacaagtca
tacaggaggttcaccatgcccacagcaggtgcaccacccagtgaaacgctcggctcctgg
ttcatcttcacattaatgagagttctacgggaaaattcacacaaggacgatttgatgaca
atgctgactaaggtgaatcaagaaatgattaaatatgcgacaggtaaaggctgcaagcag
attccaagccatgtctccatgctcacacgaaaggtcttcttcacaaatttttttaataag
acattttaa

DBGET integrated database retrieval system