KEGG   Pocillopora damicornis (lace coral): 113666447
Entry
113666447         CDS       T05773                                 

Definition
(RefSeq) mucosa-associated lymphoid tissue lymphoma translocation protein 1-like
  KO
K07369  mucosa-associated lymphoid tissue lymphoma translocation protein 1 [EC:3.4.22.-]
Organism
pdam  Pocillopora damicornis (lace coral)
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pdam01002]
    113666447
Enzymes [BR:pdam01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     113666447
Peptidases and inhibitors [BR:pdam01002]
 Cysteine peptidases
  Family C14: caspase family
   113666447
SSDB
Motif
Pfam: Peptidase_C14 Death Alpha_adaptinC2 MALT1_Ig
Other DBs
NCBI-GeneID: 113666447
NCBI-ProteinID: XP_027038038
LinkDB
Position
Unknown
AA seq 633 aa
MASEKMKRVSTLVNCLSMDILEQLGMKLNPRHPMKDFRYLAGKMNYNYESVRNFERQKNP
TVSLLYEWWMSSERNGEVKTVTHLIELLKSMGRDDAVNILRPVEFTELSQYPSGKDYQPT
HVALPPEAPFPIGGNLFGAYSTGDLKETRPPQENEYLYNNNLTPPRPACYVGDDGRSRPY
QEIIANVQHTMFSDYGSPLALEPRPQVRHPATDRQNGSDLQDGNVVLEPSSMRQPSTAPE
SPPRPVVSDKVALVIGNQQYECGKLKGLFYAEKDAYDVAQVLFTLGFKVVALVNLSLSEM
RIAVLSFCRLLGKGVYGVLYYAGHGYEDGGENFLLPVDANLKYNRQDSLRAQEILETMQA
CDTALNLLIIDSCRIRLPKKTGTVHYCKRGPKGNNIFAYSCCSQQEAYEEPNQPNGLYAT
HLLRHIRRNERIELILMDVARDVSRASSRNLIQRPCHESDAVADCRLTDPIVPDLLPEEF
GERMKLWNQAHYLPDEIPPIDQDGLVISFECRPVFSNVMEIKISAHNTNPAPLQEVVMDL
QVPTPVMSKVRLLSGELLGENGGVLEQVVQLSRLQKLLDPLVVTFKMYYRMGNEVRDWEK
TVRLGCPLVSSVFVQWDWWITCGRLPGVKCTQV
NT seq 1902 nt   +upstreamnt  +downstreamnt
atggcttccgagaagatgaagcgagtcagtacacttgtgaattgtttgagcatggatata
ctggaacagcttggtatgaaactaaatcccagacatccaatgaaagatttcagatatctt
gctgggaaaatgaattataactacgaaagcgtgaggaattttgagcgacaaaagaacccg
acggtgtccctgttgtacgaatggtggatgtcttcggaaagaaatggagaagtcaaaaca
gttacacatctgattgaacttctaaaaagcatgggaagagacgatgctgttaacattctc
agacccgtcgaatttacagagttatcacagtatccaagcggaaaagattaccagcccacg
catgtcgctctccctcctgaagcaccttttcctattggtggtaacttatttggagcatat
tccactggagatttgaaagaaacacgcccacctcaagagaatgaatacctgtacaataac
aatttaacaccacccaggccagcatgttatgttggggatgatggcagatctcgtccttac
caagaaatcattgcaaatgttcagcacacaatgttctctgattatggatcccctttagct
ttggaaccaagaccacaagtccgccatcctgcaacagatcgacaaaatggatctgacctt
caagatggaaatgttgtgttagagccaagttcaatgagacaaccaagtactgctccagaa
agtccaccacgaccagtggtatcagacaaagttgctcttgtcattggaaaccagcagtat
gagtgtgggaaattaaaagggctgttctatgctgaaaaagacgcatatgatgtggcacaa
gtccttttcactcttggatttaaggttgtggctttggtgaatctttcactgagtgagatg
aggattgcagttctttcattttgcagactcttgggcaagggtgtttatggagtactctac
tatgctggtcatggatatgaggatgggggagaaaactttcttcttccagttgatgcaaat
ctgaagtataatcgtcaagacagtctgcgtgctcaggagattcttgaaaccatgcaagca
tgtgatacagccttaaacttgttgatcattgattcttgtcgaatacggttaccaaagaaa
actggcactgttcactattgcaaaagaggaccaaaaggaaataatatttttgcatattca
tgttgttcccaacaggaggcatatgaagagccaaaccagccaaatggcctgtatgcgaca
catttactgagacatatcagaagaaatgagcgaattgagctcatacttatggatgtcgct
cgtgatgttagccgtgcaagtagcagaaatctgatccagagaccatgccatgagagtgat
gcagtagcagactgtcgactcactgatcctattgtaccagatttgctgccagaggaattt
ggggaacgaatgaaactctggaatcaggctcattatcttccagatgaaatcccaccaatt
gaccaagatggactggtcatatcatttgaatgcagacctgtgttttcaaatgttatggaa
attaagatctctgctcataatacaaatcctgctccactacaagaagttgtgatggatcta
caagtacccacgcctgtcatgagcaaagttcgccttctctctggtgaactcctgggtgaa
aatggaggagttttagaacaagtagtacagttgtctagactacaaaagttactggatcct
ctagtggtgacatttaaaatgtattaccgaatgggaaacgaagtgcgtgactgggaaaag
acagttcgccttggctgcccgctggtctcgtccgtgtttgttcaatgggactggtggata
acatgcggcagattgcccggagtgaaatgtacccaggtttaa

DBGET integrated database retrieval system