KEGG   Pocillopora damicornis (lace coral): 113669951
Entry
113669951         CDS       T05773                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 16-like
  KO
K02583  tumor necrosis factor receptor superfamily member 16
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113669951
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pdam04050]
    113669951
   04090 CD molecules [BR:pdam04090]
    113669951
Cytokine receptors [BR:pdam04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   113669951
CD molecules [BR:pdam04090]
 Proteins
  113669951
SSDB
Motif
Pfam: Death TNFR_c6 DUF1180 DUF6377
Other DBs
NCBI-GeneID: 113669951
NCBI-ProteinID: XP_027041833
LinkDB
Position
Unknown
AA seq 515 aa
MNFPPVYLSISFFKRDTMLISKFFAILVFLALSTFSAGRGIKGQCPDCIEEGYIKIIDPK
TGKCEGCWPCPECQEGAGSSVQCGSTVPKGTDIHCVSCTMGINFSNSLSTEKCKPCGVCS
GKHKHVSAECTPSSDVQCECDNRFYQNKTTHECQSCDSCCFTDADDDIIEKCQKDAEIKE
DEQSMFSPSTVIATSSSLFKSVKIHTAITPFLQSLTSISVPSRTQPIQSSSTSVSSANQK
HDVVPTESVIIMPVHKTVHEHAESMRWIKGIAYILGVFIFIILCCFLIYLFKKVRKNRQS
RSVQVVEFSPLNQSEEDSPDTRRKINGQCTHGTDGSRRNSNTVYCNKDHEVVTGDQFENM
AEKDSVQKGIPSSLDDKPSNSTDEVANMQGENHRAGCNLIPPLQPEKDNLGYSTYITDVP
LPIIGEMCRLLDIERVTDENDYRMLGYELGLKSSEITSIKQKSNNPSRVLLMEKFASKPN
SGTLNHLISLLTKLERHDVIQVIDEWVQNQTLPTN
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgaactttcctcctgtatatttgtccatatccttctttaagagggacacgatgttaatc
tcaaaattttttgcgattttggtatttcttgcactttcaacattcagtgctggtagaggt
attaaaggccagtgcccagattgcattgaggaaggatatatcaagatcatagatcctaaa
actggcaagtgtgaaggatgctggccttgtcccgaatgtcaggagggtgcaggttcctct
gttcagtgtggatcaactgtaccaaagggaacagacattcactgtgtttcttgcaccatg
ggcataaacttctctaacagcctaagtactgaaaagtgcaaaccttgtggagtctgttca
gggaagcacaagcatgtctcagctgaatgtaccccatctagtgatgtgcaatgtgaatgt
gacaatagattttatcaaaacaaaacaacccatgaatgtcagtcatgtgattcctgttgc
ttcacagatgctgatgatgacatcattgaaaaatgtcagaaagatgcagaaatcaaagag
gatgaacaatccatgttcagcccctctacagtcattgcaacatcctcatctttattcaaa
tcagtcaagatccatacagctataactccttttcttcaaagcctcactagtatttcagtt
ccttcaaggacccagccaatccaatcttcatcaacaagtgtttcatctgcaaatcaaaag
catgatgtggtacctacagaaagtgtgatcattatgcctgtacacaaaacagtacatgaa
catgctgaaagcatgaggtggatcaaaggaatagcatacattctgggtgtttttattttc
atcatactctgttgttttttaatctacctgtttaaaaaggtaaggaaaaacagacaaagc
agaagtgtacaagtagtcgaattttctcctttaaatcagagtgaagaagacagccctgat
acaagaaggaagattaatgggcagtgcacccatggtactgatggatcaagaagaaattca
aatacagtttactgtaataaagatcatgaggttgtaacaggagatcagtttgagaacatg
gctgagaaagactcagttcagaaaggaattccatcatcccttgatgataaaccctcaaat
tccacagatgaagttgctaatatgcaaggggaaaaccatagagcaggctgtaacttaatt
ccacctcttcaacctgagaaggataaccttgggtattcaacctacataacagatgtacct
ctacctatcatcggtgaaatgtgcaggctacttgacattgaaagagtcacagatgagaat
gattatagaatgctgggatatgaacttggccttaaatcatcagagatcacctcaatcaaa
caaaaaagtaacaacccatcgcgtgtgctactaatggaaaagtttgcaagcaagccaaac
tctggaacacttaatcacctcatatccttattaacaaaacttgagcgacatgatgtgatt
caggttatagatgaatgggtgcaaaatcaaacattgcccacaaattag

KEGG   Pocillopora damicornis (lace coral): 113669965
Entry
113669965         CDS       T05773                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: uncharacterized protein LOC113669965
  KO
K02583  tumor necrosis factor receptor superfamily member 16
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113669965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pdam04050]
    113669965
   04090 CD molecules [BR:pdam04090]
    113669965
Cytokine receptors [BR:pdam04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   113669965
CD molecules [BR:pdam04090]
 Proteins
  113669965
SSDB
Motif
Pfam: Podoplanin TNFR_c6 Sensor_TM1
Other DBs
NCBI-GeneID: 113669965
NCBI-ProteinID: XP_027041850
LinkDB
Position
Unknown
AA seq 259 aa
MKTAKIICCLLAVVLYEAFGNIQKRRKPGPDEIERVINATYSIFWKCTMLKCPMGHGATV
PCASSVSISTPIKCIPCIGGVNFSDSHDYTTCKSCXNCDKHEKKSGECTPESDTTKCLGT
CHKGFYMDKISGGCHPCSDCCGQDKKHHEEQCEISNLPWSMQCRENNFECPEQDTKDTTG
KSQHKGGLESSTIVGIVFGLVGFLVLVVGVIFFVHHFRSGFDCMSSPTLDGCFHGSETHF
QNPEFDPELGTGKREIHFA
NT seq 778 nt   +upstreamnt  +downstreamnt
atgaaaacagcaaagatcatttgttgtttgttggctgttgttttatatgaagcatttggg
aatattcaaaaacgtcgaaagccaggacctgatgaaatagaacgagtaataaatgctact
tattccattttctggaaatgtactatgttaaaatgcccaatggggcatggagcaactgtg
ccttgtgcttctagtgtctcaattagcacaccaataaaatgtatcccttgtattggtggg
gtaaatttctcagacagtcatgattacaccacctgcaaaagttgctgaaactgtgacaaa
catgagaaaaagtctggagagtgtacccctgaatcagataccacaaagtgtctaggaaca
tgtcacaagggcttctatatggataagatatctggtggatgtcatccatgcagtgactgc
tgcgggcaagataaaaaacatcatgaagaacagtgtgaaatttctaatcttccatggagc
atgcagtgtagagaaaacaattttgagtgccctgaacaagacaccaaggacaccacaggc
aagagtcaacacaaagggggtcttgagtcatcaacaattgtgggtatcgtatttggttta
gttggctttttagtgttggttgttggtgtgatcttctttgtacatcacttcagatcaggc
tttgattgtatgagttcacctactttggatgggtgttttcatggctcagaaacccacttc
caaaatcctgaatttgaccctgagctgggcacagggaagagggaaattcattttgcag

KEGG   Pocillopora damicornis (lace coral): 113673555
Entry
113673555         CDS       T05773                                 

Definition
(RefSeq) uncharacterized protein LOC113673555
  KO
K02583  tumor necrosis factor receptor superfamily member 16
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113673555
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pdam04050]
    113673555
   04090 CD molecules [BR:pdam04090]
    113673555
Cytokine receptors [BR:pdam04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   113673555
CD molecules [BR:pdam04090]
 Proteins
  113673555
SSDB
Motif
Pfam: TNFR_c6 Death SCF
Other DBs
NCBI-GeneID: 113673555
NCBI-ProteinID: XP_027045762
LinkDB
Position
Unknown
AA seq 449 aa
MLLVVKAWLILFLLLWSRFASGRPARCSLSRNFLRYFPDAPEAQIECIACPKCPEGTGLT
PLCGSKISNYTNIKCEPCRENATFSDTHSIESCRPCHDCGLRNIIQQCTPYQNRKCGNRC
PERHFMDDNGFCQECYFCCSDVRESSRLKSCQDIGMGRDWQCLESHENRLCKKIRETVEN
ATSTTTDVTTPAPSADLRPASDSDLNLTGMVSSKGDTREPVLKSEKNNSLPATTKTGTDK
RSTKEEGETVTSTSIALIAIGAATLVFILGAIIHYCWKRSHSDVTNSNECIPLKGIQGAK
DRDGSTETVEDVLADGDHEEPLTSELRQDQPKTDLIPADCKVSEMPQLRNNDNQILLHYV
QRMLDPLEKQTKKNWRSVGQILNVSEEDLDLIEIDYKAGRSPTVSLIDKLSTFPIVPSVR
SFVEALVSCNRYDVATNICNWPWELRTIQ
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgttacttgttgttaaggcgtggctgatcctgttcttattattgtggtcacgatttgct
tctggaaggccggcgagatgttccctgtcgcgaaatttcttacgatactttcccgatgct
ccagaagctcaaatagagtgcatagcatgtcccaagtgcccagaaggaacaggactcaca
ccattatgcggttcaaagatctctaactacaccaacatcaaatgtgaaccttgcagagag
aatgcgaccttctctgacacacatagcattgaaagctgcagaccctgtcatgactgtgga
ttaaggaacattatccagcagtgtaccccttatcaaaaccgcaaatgtggaaacaggtgc
cctgaaagacattttatggacgacaatggtttctgccaggaatgttatttttgctgctct
gatgtccgtgagtcttccaggctgaaaagctgtcaagacattggaatgggcagggactgg
cagtgccttgagtcccatgagaatagactctgcaagaaaataagggagactgtggaaaat
gctacttcaactactactgacgtaaccacacctgctcctagtgctgatctccgccctgcc
tctgattctgacctgaacttaactggtatggtttcaagtaaaggagacaccagggaacct
gtactcaaatccgaaaaaaacaattcgcttccagcaacaacaaagacaggtacagacaag
aggtcgacaaaagaagaaggggaaacagtaacatctacatctatagccttgatagctatt
ggggctgccactctagtttttattttgggtgcaatcattcactactgctggaaacgctca
cattcagacgttacaaattctaacgagtgtatacccctgaaaggtatacaaggtgccaag
gatagagatggctcaacagaaactgtagaagatgtgctggcagatggtgaccatgaggag
cctctcactagtgagcttagacaagaccagccaaaaactgatctgattccagcagattgc
aaagtttccgaaatgccacagctgcgtaacaatgacaatcaaatactcttgcactatgtg
caaaggatgctggatccactggagaaacagacaaagaaaaattggcgctctgttgggcaa
atcttgaatgtttcagaggaagacttggacttgatagaaattgactacaaagcaggaaga
agtcctacagttagtcttattgataaattgagcacctttccaatagtaccctcagtgaga
agctttgtagaagctctcgtttcttgcaacaggtatgatgtggccaccaatatttgcaac
tggccatgggagttacgtactatacaatga

KEGG   Pocillopora damicornis (lace coral): 113674168
Entry
113674168         CDS       T05773                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 16-like
  KO
K02583  tumor necrosis factor receptor superfamily member 16
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113674168
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pdam04050]
    113674168
   04090 CD molecules [BR:pdam04090]
    113674168
Cytokine receptors [BR:pdam04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   113674168
CD molecules [BR:pdam04090]
 Proteins
  113674168
SSDB
Motif
Pfam: TNFR_c6 Death MSP1a
Other DBs
NCBI-GeneID: 113674168
NCBI-ProteinID: XP_027046441
LinkDB
Position
Unknown
AA seq 313 aa
MSNLLQFAGELALGSKCPPDQFWDGSIFMCRDCTKCSEGEKLISPCQEVKDASCEKCLEG
TYLDAVNNSLCVQCSYCGEGEVVLIKCKSGNDTQCGKIPVCPLPSERSQVSTQQPSIPTM
LSSSHRTFTSQKVDEESKVPECKETRSQLNHPALLVTLGLLLLISLICNCVWFKEKIGKW
RGKDTPVPDRTVDRTAPKESVAGMSGTAVIEENNIKFSTIPANITEELAQYLNIDSGNNY
IYLAGKMKYDSTFTNNLKLLPREATQELLKDWQMRDDATVYKLYCYLEELERHDCMAILR
PLLISQGSDVAMV
NT seq 942 nt   +upstreamnt  +downstreamnt
atgtcaaatcttttgcagtttgctggagaattggcccttggatctaagtgcccaccagac
caattctgggatggcagtatatttatgtgtcgggattgcaccaaatgcagtgagggtgaa
aaactgatctctccttgccaagaggttaaagatgcttcttgtgagaagtgtctagagggg
acttatttggatgctgtaaacaactcattgtgcgttcagtgcagttattgtggagaagga
gaagtcgtattaattaagtgtaaatctgggaatgacactcagtgtggaaagattcctgtt
tgtcctcttccttcagaaagatctcaggtatccactcaacaaccatccatcccaacaatg
ttgagttcttctcacagaacatttacatcacagaaagttgatgaggaaagtaaggtacca
gaatgcaaagaaactagaagccagctaaatcatccagctttgttggtcactttaggtctg
cttcttttaatatcattgatctgcaattgtgtttggttcaaagaaaagattggaaagtgg
aggggtaaagatacaccagtaccagacagaactgtagacagaacagctccaaaagagtct
gtagctgggatgtcaggaacagctgttattgaagagaataacattaaattcagcaccata
ccagctaacatcactgaagaattagcacagtaccttaatatagacagtggaaacaactat
atttatttggctggaaaaatgaaatatgactctaccttcacgaataatctgaagctgtta
ccaagagaagccacccaagagcttcttaaagattggcaaatgcgagatgatgctacagtt
tacaaactgtactgttatttagaggaactggaaaggcatgactgcatggctatccttcgg
cctctcctcatcagccagggaagcgacgttgctatggtttga

KEGG   Pocillopora damicornis (lace coral): 113682648
Entry
113682648         CDS       T05773                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 16-like isoform X1
  KO
K02583  tumor necrosis factor receptor superfamily member 16
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113682648
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pdam04050]
    113682648
   04090 CD molecules [BR:pdam04090]
    113682648
Cytokine receptors [BR:pdam04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   113682648
CD molecules [BR:pdam04090]
 Proteins
  113682648
SSDB
Motif
Pfam: TNFR_c6 Death RIFIN TMEM154 DUF1180 Ephrin_rec_like DUF6479 EphA2_TM Peptidase_M56 Orf78 CD34_antigen DUF6377 DUF5305 DUF2140 V_ATPase_I DUF4381
Other DBs
NCBI-GeneID: 113682648
NCBI-ProteinID: XP_027055611
LinkDB
Position
Unknown
AA seq 439 aa
MTKINSDVTWKGKKPEHTHVGSTFKRLPSLAFSRIEEGPKMVARSLALLATIFGSSLLIT
TIAVGCGPGTFLNSTALVCQKCPNGTFSAHENARMCSTCKRCMGRNNVMVKACTPTSDTK
CECLPGHYFNGFLICLKCQPCKRGYGFVKNCTATTNTVCERCERGKTFSVGKGFDACKPC
SKCQKGEVVKETCIRRRNTKCTPEKDFNNSKLKPFLLVPTKSKPRTNGDTRIAKEEPSKS
SSGSESFSTLSTIISSTTAVTGKQKEYESLEEEETSFQAILFSLVALLVLVMIVVAIFVL
RRRRSNRKRPKNRGKSVDSCEEQSTRSNSIEVVGAVENPYTSLPCIGGRQGDKLLRDAPY
TLITDLSQYLNPGDRWKQLGGRLKFNSTQINNFALDRRTATEAMLVEWGQRDTSTVAALR
DIFRAMKWSKEAKITATYV
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgacaaaaataaacagtgacgtcacatggaagggaaaaaaacccgaacacactcacgtg
gggtcgaccttcaaaagattgccgagcttagcattttcgcggatcgaggagggaccaaag
atggtagcgcgctctctcgcgcttctggcgactattttcgggagctctttgctgattacg
acaatcgccgtgggatgcggtccaggaacctttcttaattcaactgctttggtttgtcag
aagtgtccaaatggtacattttcggctcacgaaaatgcacgaatgtgttcgacgtgtaaa
aggtgtatgggtaggaacaacgtgatggtcaaagcatgtacccctacctcggacacgaag
tgcgagtgcctgcctggtcactactttaacggatttctgatttgtctcaagtgccagcca
tgtaaacgaggatatggatttgtgaaaaattgcacagcaacgacgaacacagtttgtgaa
cggtgtgagaggggaaaaacattctcagttggcaagggctttgatgcttgtaaaccatgt
agcaaatgtcagaagggagaggttgttaaagaaacctgcatacgaagaagaaacacaaag
tgcacaccggaaaaagattttaataattcgaaactgaaaccttttttacttgtacccacc
aaatcaaagccacgaactaatggtgatacacggatagcgaaggaagagccgtcaaaatct
tcatcaggatctgaatctttttcaactctttccacgattatatcgtctacgacggctgta
acggggaagcagaaagagtatgaatctttggaagaggaagaaactagctttcaggctatc
ttgttctctctggtcgcattgctggttttggttatgattgttgtggccatttttgtcttg
cgcaggaggcggagcaacagaaaacgcccaaagaacaggggcaagtcggtagattcttgc
gaggaacagagtacgagatcaaactcaatcgaagtcgtaggagctgtagaaaatccttac
acctctttaccctgtattgggggacgacaaggtgataaattgctacgtgacgctccttac
acccttattacggatctatcgcaatatttaaatcccggagacagatggaaacagttgggg
ggacgactcaaattcaacagcacccagatcaataattttgctttggataggagaacagca
actgaggctatgcttgtggaatggggccagagagacacttccactgttgcagcgctcaga
gacattttcagggccatgaaatggtcgaaagaagcgaaaatcaccgcaacgtatgtgtag

KEGG   Pocillopora damicornis (lace coral): 113684803
Entry
113684803         CDS       T05773                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 16-like
  KO
K02583  tumor necrosis factor receptor superfamily member 16
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113684803
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pdam04050]
    113684803
   04090 CD molecules [BR:pdam04090]
    113684803
Cytokine receptors [BR:pdam04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   113684803
CD molecules [BR:pdam04090]
 Proteins
  113684803
SSDB
Motif
Pfam: TNFR_c6 SKG6 DUF4514 Vpu Syndecan FAM176 MLANA Mid2 TMEM51 Glycophorin_A LST1
Other DBs
NCBI-GeneID: 113684803
NCBI-ProteinID: XP_027058004
LinkDB
Position
Unknown
AA seq 364 aa
MSFSKFVSPCHGDSIAIYNSTSGAVKCQACVKCPQGRGLSVQCSSVQSPETPIVCEPCVH
GKTYSSGKDAGACLSCENCEEYRETIKACTLTSKAVCGKCKPGAYQDDQLTRLCQPCSRC
CDDQDDQVEPQCQEMPENKRCSFHRSHVCSKVITRANFSSVSSVETNHTASLVLVSSPTS
QVTTSSSMHTAYQKTPVADRPSRAAIIGAAVGVTLAVVLLLLVICYFLKKKSNHRVNKRV
NDAERPQETRSKKESSGTDLERLNTERSQTAEDSNATSPGSKETQILVQNSTDACKLSIE
ESEATSPGVEETQPPDYNNTEHQLFKKAPKDNSCHTMVKTTTINTVTYCSTCSSGPESTG
YGEE
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtctttttccaagttcgtatccccttgtcacggtgacagtattgcgatatacaactct
accagcggagcggtcaagtgtcaggcctgtgttaaatgcccccaaggacgaggcctctct
gtgcaatgcagttctgttcaaagcccagagacacccatagtttgcgagccatgtgtgcat
gggaaaacatactcatctggaaaagacgccggggcatgcttgagctgtgagaattgtgag
gagtatcgcgaaaccataaaagcctgcactctgacttccaaggcagtgtgtggaaagtgt
aagcctggcgcttaccaagatgaccagctaacacgattgtgccagccctgctcccgctgt
tgtgatgatcaagatgatcaagtcgagccacagtgccaagaaatgcctgaaaacaagcgg
tgcagttttcacagatcacacgtatgcagcaaagttataactcgtgcaaatttcagctca
gtcagctctgtggaaacaaaccacacagcatcactggtattggtgtcgtctcccacaagc
caggtaaccacctcatcgagcatgcacactgcatatcagaagaccccggtggctgatcgt
ccttcgagagccgcaatcatcggtgctgctgttggtgttacattagctgttgtcctgttg
ctgttggtcatttgctattttcttaaaaaaaagagcaatcaccgagtaaataagagggtt
aatgacgccgaaaggccgcaagaaacacgaagcaaaaaagagtctagtggaactgattta
gaacggttaaacacagaaaggtcacagacagcagaagatagtaacgccacatcgccaggg
tccaaggaaactcaaatacttgtccagaacagtacagatgcctgcaagctatcaatagag
gaaagtgaggctacttcgccaggtgtcgaagaaactcagccaccggactacaacaacaca
gagcaccagctgttcaagaaggctcccaaagacaacagttgtcacactatggtgaagacg
accactataaacaccgtgacctactgttcaacttgtagttctggtccagaatctacaggg
tatggagaagaatga

KEGG   Pocillopora damicornis (lace coral): 113685518
Entry
113685518         CDS       T05773                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 16-like
  KO
K02583  tumor necrosis factor receptor superfamily member 16
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113685518
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pdam04050]
    113685518
   04090 CD molecules [BR:pdam04090]
    113685518
Cytokine receptors [BR:pdam04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   113685518
CD molecules [BR:pdam04090]
 Proteins
  113685518
SSDB
Motif
Pfam: TNFR_c6 Death Insulin_TMD DUF6479 EphA2_TM Cadherin_C_2 CD34_antigen TrbC Protocadherin TMEM154 SpoIIIAH LRR19-TM T4SS_pilin ECSCR DAG1 SIT ASFV_J13L RIFIN Chordopox_A13L Adeno_E3_CR2 DUF6216 YjdM_Zn_Ribbon
Other DBs
NCBI-GeneID: 113685518
NCBI-ProteinID: XP_027058827
LinkDB
Position
Unknown
AA seq 415 aa
MERHFLIIFALSGLLVYALDCPDNMYQSGSLCCKYCPVGKYMTKTCNVSKGNSFCESCPS
ETFMDKQNNNSKCKQCQKCPPSQTATRHCKPIHNRECGCPPGTYHDKEVLICLECLKCNV
GYGAVSPCTNISNTECQPCREGTFSDRVSHEQECLNCSQCDPGAVIKEECTATRDTICQR
ANNSRISTVSQVVTSVSRAPSAPTNAGRSLSPVEKVTSNSIRYIIGIVVTVVLLVIIVVA
IYCCWRKQNRHEGNQAHNPQEMEEAKYDFVPPTSSETPAHARSSYGLRGRRTVYSTRPNS
HQRDSDSQGSSGSLQGVSVSNGKSKTLVRDLPAHVFIELGKFLNPKSSKNWVTLAGYLEF
TTNEIKNFELEVNEATQNVLYQWGQKDSSTVDFLINVLKKMKRDDCVQVLKPWDN
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggagcgacattttttgattatttttgccctttctggtctcttggtttatgcattagac
tgccctgacaatatgtaccagagcggctcgctctgttgcaagtactgtccggtaggaaaa
tatatgacaaagacctgcaacgtgagcaaaggaaattctttttgtgaatcatgcccgagt
gaaacgttcatggataagcagaacaacaacagcaagtgtaagcagtgtcagaaatgccca
ccgtcccagacggccacacggcattgcaagccaattcacaatagggaatgtggatgcccc
cccggaacgtaccacgataaagaagtcttgatttgcttagaatgtctgaaatgtaacgta
ggctacggggcggtgtcaccctgcacaaatataagtaacacggaatgtcagccctgtcgg
gagggaacattttctgatcgcgtcagtcacgaacaggaatgtttgaattgctcacagtgt
gatccaggcgcagtgattaaggaagaatgcacagcaacaagggacacaatctgccagaga
gcgaacaattcacggatttctactgtttcccaagttgtcacttcggtctctcgagcgcct
tcggcaccaaccaatgctggacgttcattaagccccgtagagaaagtaacatctaactcc
ataaggtatatcattggcatcgttgtcactgtagtgctcctcgttataattgttgtggct
atttactgttgctggaggaaacaaaatcggcatgaaggaaaccaggctcataaccctcaa
gaaatggaggaagcgaagtatgactttgtgccgccgacttcatcggagacaccagctcac
gcgcgatcctcgtacggacttcgaggaaggcggacggtctactccacgagaccaaatagt
catcaacgagattctgactctcagggcagtagtggctcgttacagggcgtcagcgtaagc
aacggcaaaagtaaaacgttggttcgggaccttcccgctcatgttttcatcgaacttgga
aagtttttaaaccccaagtcaagcaaaaactgggtgacacttgcgggatacctcgagttt
actacgaatgagataaaaaactttgaacttgaggtcaacgaggctactcaaaacgtgctt
tatcaatggggacaaaaagatagttccaccgtggatttccttatcaatgtattgaagaaa
atgaagagggatgactgcgtgcaagttcttaagccgtgggataattga

KEGG   Pocillopora damicornis (lace coral): 113687083
Entry
113687083         CDS       T05773                                 

Definition
(RefSeq) uncharacterized protein LOC113687083
  KO
K02583  tumor necrosis factor receptor superfamily member 16
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113687083
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pdam04050]
    113687083
   04090 CD molecules [BR:pdam04090]
    113687083
Cytokine receptors [BR:pdam04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   113687083
CD molecules [BR:pdam04090]
 Proteins
  113687083
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 113687083
NCBI-ProteinID: XP_027060595
LinkDB
Position
Unknown
AA seq 445 aa
MQSVFVFLVFSCFCLEVHHVFCKICPDDKYTIVSSNGSFVKCSPCDTCHPGWGLYPLCGT
QLTNERMSEISCKVCPSGTFSAELDSSPCKNCQQCAPHEIASASCTRVSDTSCNKTCDKG
YFFVEVSHSCQQCSYCCFDKKDEPQPECIKHGFNATGQYCSIRLDKTCTPVHPTTRTTLP
AIVTRITQYHDKSAPPATSGKVPGDTTKSSTQNTATIVLGVLASIFAAALIVGFLCWIIR
RKIQRRKRGIDYGNNSEALKDTSYASKGPTLSNSSTVVPLPSPIVKALQINSGYAPSSSE
DDEVDDLRNPKDELRKKRILKRQISKEAGASKDSASVLGSIEKDSDENKGQDKNDVGVAV
PRKSSLVRKLSKGHYQPLLGEDSDEQDEIVQEGVRGSSVPSIRFKASKRKSSGAGTPNKE
DFQDPKEDDDTKIVAKPFKVVVQPR
NT seq 1337 nt   +upstreamnt  +downstreamnt
atgcagtcagtatttgtgtttttagtcttttcctgcttctgtttggaagtacatcacgtc
ttttgtaaaatctgtcctgatgacaagtataccattgtcagctcaaacgggagctttgtg
aagtgctctccttgtgacacatgtcatcctggttggggattgtatcctctatgtggaaca
caacttacaaatgaaagaatgtctgaaatatcttgcaaagtatgcccttcaggcacattt
tctgccgagctagactcttccccttgtaaaaactgtcaacagtgtgcccctcatgagata
gcatctgccagttgcaccagggtatcggatacaagttgcaataaaacatgtgataaggga
tacttctttgttgaggtctctcacagctgtcaacaatgttcatattgttgttttgacaaa
aaagatgaaccacagccagaatgtatcaaacatgggttcaatgctactggtcaatactgt
agcattcgattggataagacttgcactccagtgcatccaactactaggacaaccttgcca
gcaattgtgacacgtataacgcagtaccatgacaaatcagcccctcctgctaccagtgga
aaagtacctggtgatactactaagagcagcactcagaatactgccacaatagtacttggt
gtgctggcttctatatttgccgctgcactaattgttggattcttatgttggataattaga
aggaagatacaaaggagaaagagggggattgattatggtaataacagcgaagcactgaaa
gacaccagctatgctagcaaaggacccacactgtcaaattccagtactgtggtgccatta
ccatcccctatagtaaaagcattacagatcaactcaggttatgctccatcctcttcagaa
gatgatgaagtagatgacctgcgtaacccaaaggatgaattacgaaagaagcgtatttta
aaacgacaaattagtaaagaagcaggagcatcaaaggacagtgccagtgttttaggatcc
atagagaaagacagtgatgaaaataaagggcaagacaaaaacgatgttggtgtagcagtg
cctaggaaatcaagtcttgtaaggaaactgtccaaaggtcattatcagccattattagga
gaggattcagatgagcaagatgagattgtgcaagagggagtaagagggtccagcgtgcct
tccataagattcaaggcatcaaaaaggaaatcatccggtgctggcacccctaacaaggaa
gactttcaggatccaaaagaagatgatgatactaaaattgtagcaaaacctttcaaggtt
gtggtgcaacccagaca

DBGET integrated database retrieval system