KEGG   Pocillopora damicornis (lace coral): 113670454
Entry
113670454         CDS       T05773                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein homolog B-like
  KO
K02561  Bcl-2-related ovarian killer protein
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113670454
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 113670454
NCBI-ProteinID: XP_027042396
LinkDB
Position
Unknown
AA seq 256 aa
MKIILDFLTRLWITVVNYLFPKKIKERKRTLSIEETIISEQAAFLCQKYIEARFTRSNLC
YYNPKSRKRDGEPTIACPEDVVNTLNEMGALLEKSYPKLYNNVLDQLNWRINLAILVCNM
FNRVSEQIIASGVNWARIIAVYAFAGALAYDLTQTGDTRFIRCLSRWMGHFSARRLSPWI
RQNGGWKGLVTHFKEEEQSLMGSLSRWLSGSQPRKEQPESETASSRGSGHEYSKGRRTKK
LSSVLVQVSGNFKVNL
NT seq 771 nt   +upstreamnt  +downstreamnt
atgaaaataattttggattttctaactcgtctgtggattactgtcgtgaattatttattt
cccaaaaagataaaggagagaaaaagaacgctgtcgattgaggaaactattatttcagag
caagccgcttttctgtgtcagaaatacatcgaagcaagattcacgcgatcaaatctgtgc
tactacaacccgaagagccggaagagagacggagagcccacaattgcatgtcccgaggat
gtagtcaacacattgaacgaaatgggcgctttgcttgagaaaagctacccaaaactctat
aacaacgttttggatcaactaaactggcggataaaccttgctattctcgtttgtaacatg
ttcaatcgcgtctccgagcaaattatagcttctggcgtgaactgggctcggattatcgct
gtttacgctttcgccggcgcactagcctacgatttaacacagacaggagacacaagattc
atccgttgtctgtcgaggtggatgggtcatttctccgccagacgtttgagtccatggatc
agacagaatggaggatggaaaggccttgtgacacatttcaaggaagaggaacagtcatta
atgggctcgttaagtagatggctttcagggagtcaaccaagaaaggagcaaccagagtct
gaaacagcctcttcgagaggttcaggacacgaatacagtaagggaaggaggaccaaaaaa
cttagttcagttttagtgcaagtcagtggcaacttcaaagtgaacctctaa

KEGG   Pocillopora damicornis (lace coral): 113673765
Entry
113673765         CDS       T05773                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein-like
  KO
K02561  Bcl-2-related ovarian killer protein
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113673765
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 113673765
NCBI-ProteinID: XP_027046003
LinkDB
Position
Unknown
AA seq 224 aa
MLKSVTKKLKPFIEAKLNEEYVSIANDANLYCLDYIEERLKRSNIDSNLEFIRPKAVSES
TLSISLKIIEVGELLETSYPHLYNNVSKQLKVKLRSEVIVGDIFRNFGRELFREGVTWGR
IVALFAFAAAISADCITQGRPELVKNVLSCVRLYVLDHLAVWIRSQGGWVDISETFKCIE
KRYSMAYFLRWFDYNRLWLVNTTKERLHSFLCATVECIGLIDGG
NT seq 675 nt   +upstreamnt  +downstreamnt
atgctcaaatctgtcactaaaaagttgaaaccgttcattgaagcaaaacttaatgaggaa
tatgtgtctatagcgaacgatgcgaatttgtactgtttggactacattgaagagcgactg
aaacgctccaatatcgattcaaatcttgaatttatccgacccaaagctgtgtctgagagc
actctatcaatttctttaaaaataatcgaagtcggcgagcttctggaaacatcttatccc
catctttataacaatgtttcaaaacagctcaaggtaaaattacggagcgaggtaatagtc
ggcgatattttcagaaactttggacgcgagctgtttcgggaaggcgtcacttggggacga
attgtagccctgttcgcgtttgcagctgctatcagtgccgactgcataacacagggacga
ccagaactcgtgaaaaatgtacttagttgcgtcaggctctatgttttggatcacttggcg
gtttggataaggagccaaggcggatgggttgatatcagcgaaacatttaaatgcattgaa
aagagatattcaatggcgtatttccttcgatggtttgactacaacagattgtggctggtc
aatacgacgaaggaaagacttcactcgtttctgtgcgcaacagtagagtgcattggtctc
attgacggaggctaa

KEGG   Pocillopora damicornis (lace coral): 113683782
Entry
113683782         CDS       T05773                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein-like
  KO
K02561  Bcl-2-related ovarian killer protein
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113683782
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 113683782
NCBI-ProteinID: XP_027056867
LinkDB
Position
Unknown
AA seq 262 aa
MATLQRPKAVKRLSWQDLSPDSPRIQLTRRIVQLQGNKTSADILEQAKQICNDYIEAKLE
REGLKNRSWSFTFSNSAPRQESGEMVSQVSIRVREVGRLLEQSYPRLYRDISGRINVPFN
SENTVHDVFNNVSSEILSDGLNWARIVALYAFAGALVAECCKEGRNSYVLEIGNWMYEFA
ALYMVDWIKSKGGWEDLLRAFPSLTPTGLGTSIDVQATQWYSWFVMAVRAWCETAFEFLE
YCFKAYMERVRKMNTGSRKISH
NT seq 789 nt   +upstreamnt  +downstreamnt
atggcgacgttgcagcggcctaaagcagtaaagaggttaagctggcaggacttgtctcct
gacagcccgagaattcagttaacaagacgaatcgtgcagctacaaggaaacaaaacgtct
gctgacattctcgaacaagcaaagcaaatatgtaatgattatattgaagctaaacttgag
cgcgaaggcttaaaaaatcgaagctggtctttcactttctccaattcagcaccgcgtcaa
gagagcggtgagatggtttctcaagtatcaatccgtgtgcgggaagttggtagactcctt
gaacagagctatccccgtttatacagagatatttctggccgtattaatgtcccttttaac
agcgaaaacaccgttcatgatgtatttaataatgtttcgtcggaaatcttgagcgatgga
ttaaactgggcgagaattgttgctctgtatgcgttcgctggtgcgctcgttgctgaatgt
tgcaaagagggtcgcaattcttacgtgctggaaatcggaaactggatgtacgaatttgca
gctctctacatggtggattggatcaaaagtaaaggtggatgggaagacctcttacgagct
ttcccgagcttaacaccgactggtttgggaacgtcgattgatgttcaagctactcagtgg
tacagttggtttgtgatggctgttagggcgtggtgtgagacggcttttgagttcctggaa
tactgcttcaaagcttacatggaaagagtgcggaaaatgaatactggctctcgtaaaata
agccactga

DBGET integrated database retrieval system