KEGG   Pocillopora damicornis (lace coral): 113671173
Entry
113671173         CDS       T05773                                 

Definition
(RefSeq) serine protease HTRA2, mitochondrial-like isoform X1
  KO
K08669  HtrA serine peptidase 2 [EC:3.4.21.108]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113671173
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pdam01002]
    113671173
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pdam03110]
    113671173
Enzymes [BR:pdam01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.108  HtrA2 peptidase
     113671173
Peptidases and inhibitors [BR:pdam01002]
 Serine peptidases
  Family S1: chymotrypsin family
   113671173
Chaperones and folding catalysts [BR:pdam03110]
 Other chaperones and cochaperones
  DegP / HtrA
   113671173
SSDB
Motif
Pfam: Trypsin_2 Trypsin PDZ_2 PDZ_6 PDZ Peptidase_S46 Tricorn_PDZ Peptidase_S32 LSM SM-ATX
Other DBs
NCBI-GeneID: 113671173
NCBI-ProteinID: XP_027043185
LinkDB
Position
Unknown
AA seq 432 aa
MAAQSMWRRWPKCREVLWPSHRWKEREIRPLCRRFSIETKEMGKRFPWTLLGSLAVGFSL
GYLLSKHRENELAGNRSLTVAAKTKFQDGVNSADSGSPPRSATFNFIADAVEKAAPAVVY
IEITGRRAGFGFMGHTGPTSSGSGFIVTEDGMLLTNAHVVENAAKVTVKLKDGREFSGIV
VDLDFENDLAVVQLESDKNIKFPTLTLGSSSTIRPGEWVVAMGSPLQLSNTITAGIVSTV
HRAGGEIGLPNPEMEYIQTDAAINVGNSGGPLVNLDGHVIGINAITVRFASGISFSIPID
TAKEFLSQAIERFKSGKLTQNKSLKRQLAPYERWYIGVSMLTLTPQILEQLRRRDQSFNK
VKSGVFIPQVNYGSPAHRAGVLPGDIITKINGNKIVSNKEVYRHVNRGETFEVEVKRGDK
HLKFTLEPEVVG
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggcggctcagagtatgtggagaagatggcctaaatgtcgagaagtgctgtggccttca
catcgatggaaagagagagaaattcggcctctgtgtaggagatttagtatagaaacaaaa
gaaatgggtaaacgatttccctggactttattgggttcattagctgttggtttctccctt
ggatatctgttatccaagcacagagagaatgaactggctggcaatcgtagcctgacggtt
gcagcaaagacaaaatttcaggatggggtaaattcagccgattctggatcacccccacga
tctgcaacgttcaactttattgcagacgctgtggaaaaagctgcacccgctgttgtgtac
atagaaatcacgggacgacgcgcgggattcgggttcatgggacacacaggtcccactagc
tcgggttctgggtttatagtaactgaggacggtatgcttctgacaaatgcacacgtcgta
gagaacgctgcaaaagtgactgtgaagctaaaggatggaagggaatttagtggcattgtt
gtagatcttgactttgaaaatgacctggcagtcgtgcagctagagtcggataagaatatt
aaattcccaacacttacccttggttcatcatctacaattagaccaggagagtgggttgta
gctatgggcagccctctccagctcagtaacactataacagctgggattgtcagtacagtg
catcgtgcaggtggagagattggacttccaaacccggagatggaatatatccagacagat
gcagcaataaatgttggaaactcaggaggacctctggttaatctggatggtcatgttatt
gggatcaatgcaataactgtaagatttgcgagtggaatttcattttccatacctattgac
actgctaaagagtttctatcacaagcaatagagagatttaagagtggtaaactcacacag
aacaaaagtttgaagagacaactggctccatatgaacgctggtatattggtgtcagcatg
ttgacactgactccacagatactggagcaactgcggcgaagggaccaaagtttcaataaa
gtgaaatctggagtgtttattccacaagttaactatggatcaccagcacatagggctggt
gtgctacctggtgatataataacaaaaataaatggcaacaaaatagtgtccaataaagaa
gtgtaccgacatgtaaacagaggagaaacctttgaggttgaagtaaagagaggggataag
catctcaagttcacccttgaacctgaagttgtgggataa

DBGET integrated database retrieval system