KEGG   Pocillopora damicornis (lace coral): 113671473Help
Entry
113671473         CDS       T05773                                 

Definition
(RefSeq) glutathione S-transferase U20-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00480  Glutathione metabolism
pdam00980  Metabolism of xenobiotics by cytochrome P450
pdam00982  Drug metabolism - cytochrome P450
pdam00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    113671473
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    113671473
   00982 Drug metabolism - cytochrome P450
    113671473
   00983 Drug metabolism - other enzymes
    113671473
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pdam02000]
    113671473
Enzymes [BR:pdam01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     113671473
Transporters [BR:pdam02000]
 Other Transporters
  Pores ion channels [TC:1]
   113671473
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_3 GST_C GST_C_5 GST_N_4 Fer4_5 GHL6
Motif
Other DBs
NCBI-GeneID: 113671473
NCBI-ProteinID: XP_027043483
LinkDB All DBs
Position
Unknown
AA seq 237 aa AA seqDB search
MMTESKPKLYCAWFCPFAHRAWISMLAKKIDFDYVEQDPYNKSAEWLAINPRGLIPCIVH
NGKSIYESHICIEYVDEAWPNAPRLLSREPYQRAKARMWGDFIIKKLIPPYYKFLMKQSR
EEQNEYREIFLENILEFSQAMDQSGPFFQGKELGYVDIMFAPWASRMYILEHYRGFKIPQ
TEEYSRYNVWAEAVINHPSVKAVQANKDKVLANARPYAEGNAKSELADAVRKGSTIP
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgatgacagaaagcaaaccgaagctgtactgtgcctggttctgtccatttgcacacaga
gcatggatctcaatgttagcaaaaaaaattgattttgattacgtagagcaggatccttac
aacaagtctgctgagtggctagccataaaccctcgtggattaataccatgcatcgttcac
aatggcaagtcaatctatgagagccatatttgcattgaatacgttgacgaggcctggcct
aacgcaccaaggctactgtcccgagaaccttatcagagagctaaggcacgaatgtgggga
gattttatcataaagaagcttattccaccatattacaaattccttatgaagcagtctcgg
gaagagcaaaatgaataccgagaaatatttttagaaaacatattggaattttctcaggca
atggatcagtcaggccccttttttcaaggaaaggaacttggatatgttgacatcatgttt
gccccatgggcttcaaggatgtacattctggaacattaccgtggctttaaaattccacag
actgaagaatacagcagatataatgtatgggcagaagcagtaataaatcacccttcagta
aaagcagttcaggcaaataaagataaggttttggcaaatgctaggccttatgctgagggt
aatgccaaatctgagcttgcagatgctgttcgcaaagggtcaacaattccttag

DBGET integrated database retrieval system