KEGG   Pocillopora damicornis (lace coral): 113671519Help
Entry
113671519         CDS       T05773                                 

Definition
(RefSeq) DNA ligase 1-like isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam03030  DNA replication
pdam03410  Base excision repair
pdam03420  Nucleotide excision repair
pdam03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    113671519
   03410 Base excision repair
    113671519
   03420 Nucleotide excision repair
    113671519
   03430 Mismatch repair
    113671519
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pdam03032]
    113671519
   03400 DNA repair and recombination proteins [BR:pdam03400]
    113671519
Enzymes [BR:pdam01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     113671519
    6.5.1.6  DNA ligase (ATP or NAD+)
     113671519
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     113671519
DNA replication proteins [BR:pdam03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    113671519
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     113671519
DNA repair and recombination proteins [BR:pdam03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     113671519
   NER (nucleotide excision repair)
    Other NER factors
     113671519
   MMR (mismatch excision repair)
    Other MMR factors
     113671519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 113671519
NCBI-ProteinID: XP_027043537
LinkDB All DBs
Position
Unknown
AA seq 1031 aa AA seqDB search
MTQRGITAFFSPCAKPKVKDRSEEGVASNDDIEVKEERTPLKFKPQTTALDSPPVKKTCK
QKSRRILDDASDEENNKEDFSPAKHSEHVDILKQNTVLQEENTKTEHCEVGDNKKESKFI
EVMSPQNERMRIPKRKTGLFSAPRKPAKRKASSEEESSGENQAKVVKRAKSEQDSQENQR
ENLDKAGNPTSNEMKMEKAERGLNSRVKEATIVKCEKDQTARGSESKGRMKEKENESGEE
LTEMKEDTEEGEKKKKTKSKKNLKSDGAKGDMRLIGSKHAETKEQIKSSKENGEGDSETV
IKKDKEKEISSSQDSRGERKVKGAFIDFFSPKRSKKEESNNEKLPEKSKSDRDNPPTKKT
SSSNKTGLSEPVKATEYSPEKSDYHPIKNACWKHGERVPYLAVAKSFQAIEDTSARLKIT
SILSNFFCSVIVLSPDDLLPCVYLCLNKLAPAYEGIELGIGENILMKAVAESTGRSLQQI
KCDVGEKGDLGIVAESCRSTQRTMFAPPKLTATSVFTKLKEIAMMTGHSSMTRKSEKIKG
MFVACRDAEARYLIRSLGGKLRIGLAEQSVLTALGHAVFLTPPNKEFPPPILDNAKNFSG
DALKKKQDEAALIVKTCYCEMPSYDKLIPSLLEHGLETLPEHCHLTPGIPLKPMLAHPSK
GVEEVFKRFEDAAFTCEYKYDGERAQIHVLESGEIHIYSRNQENNTSKYPDIIERMPKVL
GDEVKSCIIDAEAVAWDREKKQILPFQILSTRKRKDADASEIKVQVCVYAFDLLYLNGRS
YIKETFRTRREALRSSLTEVEGEFMFAQSSDSINTDDIAEFLDESIKGNCEGLMVKTLDM
DATYEIAKRSHNWLKLKKDYLTGVGDTLDVVVIGGYLGKGKRTGSYGGYLLACYDPENEE
FQTICKIGTGFTDELLDKHYQFFKDQVIPHPKAYYRYDDNLAPDHWFDPVQVWEIRAADL
SVSPVHKAALGLVDPVKGISLRFPRFLRIRDDKKPEQATDSSQVAEMYRSQETVKNNANP
PPTIDASDDFY
NT seq 3096 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaagaggaataactgcatttttctctccgtgtgcgaaaccaaaggttaaagat
aggagcgaagaaggagtagccagtaatgatgacattgaagtgaaagaggagaggactcca
ctgaagttcaaacctcaaactacagctttagattcacctccagtcaaaaagacttgcaaa
caaaaatcacgccgcatacttgatgatgctagcgacgaagaaaacaataaagaagacttt
tcaccagccaagcacagtgaacatgttgatatcctgaaacaaaacactgtattgcaagaa
gaaaatactaaaacagagcattgtgaagttggtgacaataagaaagaaagcaaattcata
gaagtgatgtctccacaaaatgagaggatgcgtatccctaaacgaaagacaggtcttttc
tcagcaccaagaaaacctgccaaaaggaaggcctcaagtgaggaagaatcttctggggaa
aatcaggccaaagtggtgaaacgagcaaagtcagaacaggactctcaggaaaatcaaaga
gaaaatcttgacaaggcaggcaatcctacatcaaatgaaatgaaaatggaaaaagcagag
agaggattaaactctagagtcaaggaagcaactattgttaagtgtgagaaagatcaaaca
gcaaggggatcagaatctaagggcagaatgaaagaaaaagaaaatgaaagtggcgaagaa
ttaactgagatgaaagaagataccgaagaaggcgaaaaaaagaaaaaaacaaaatcaaaa
aaaaatttaaagagtgatggagcaaaaggtgatatgaggctgataggctcaaaacatgct
gaaacaaaagaacagattaagtctagtaaggaaaatggagagggagattctgagacagtg
ataaagaaagataaagaaaaagaaatatccagtagtcaagactccaggggtgaaagaaaa
gttaaaggagcattcattgacttcttctctcctaaacggtccaaaaaggaagaaagtaac
aatgaaaaacttccagagaagagtaaaagtgacagagacaatccaccaacaaagaaaaca
agctcttcaaataaaactgggctcagtgaacctgtgaaggccacagaatattctccagag
aaaagtgactatcaccccattaaaaatgcttgttggaaacatggagaaagagtaccttac
ttggctgtagccaaatcatttcaggccatagaagacacttcagcaaggttgaaaatcacc
tccatcctcagcaatttcttctgttcagtgattgttctttctcctgatgatttgcttcca
tgtgtttatctctgtcttaataagctggctccagcatatgaaggaattgaacttggaatt
ggagagaacattctgatgaaagcagttgcagagtcaacaggacgaagccttcaacagata
aagtgtgatgttggggaaaagggagatttgggaatagtagctgagagttgccgaagtaca
cagcgcaccatgtttgccccacccaaactaactgctacaagtgtctttaccaaactgaaa
gaaattgcaatgatgactggacacagttccatgacaagaaagtcagagaaaatcaaaggc
atgtttgtagcttgtcgtgatgcagaagcaagatatttgattagatctttaggaggcaag
ttaagaattggtcttgcagaacaatcagtgttaacagcccttggacatgctgtctttctc
acccctcctaataaagagttccctcctcccattcttgacaatgctaagaatttttctggt
gatgcattgaaaaagaaacaagatgaggctgctttaattgtcaagacctgttactgtgaa
atgcccagttatgacaagctgattccatctcttttggaacatggcctagaaacactgcct
gaacactgtcatctaacaccaggtattccactgaagccaatgctggctcatccttccaaa
ggagtggaagaagtattcaaaaggtttgaggatgcagccttcacatgtgaatataagtat
gatggagagcgagcccagatccatgtactagaaagtggagaaattcacatttacagccga
aatcaggagaacaacacatccaagtatcctgacattattgaaagaatgccaaaagtttta
ggtgatgaggttaagtcctgcataattgatgctgaagctgttgcgtgggacagggaaaag
aaacagattcttccttttcaaattcttagtacacgtaaaagaaaggatgctgatgcctca
gaaataaaagttcaagtttgtgtctatgcatttgatttgctgtacctgaatggaaggtca
tacatcaaggaaacatttcgaactcgacgagaagctttacgatcatcactcacagaagtt
gaaggggagttcatgtttgctcagagttctgattcaataaacacagatgatattgcagaa
ttcttggatgagtcaattaaaggtaattgtgagggtctgatggttaaaacccttgacatg
gatgccacatatgaaattgcaaaacgctcacataattggttgaagttgaagaaagactac
ctaactggtgtgggagatactttagatgtagttgtcattggaggttatctgggtaaaggc
aaaagaactggctcatatggtggatacctgctggcctgctatgatcctgagaatgaagaa
ttccaaaccatctgtaaaattggaacaggttttacagatgagctacttgacaaacattac
cagttttttaaggatcaagtgatcccacatccaaaggcctattatcgctatgatgataat
ctggctcccgatcattggtttgacccagttcaggtttgggaaatcagagcagcagatctt
tcagtttctcctgttcataaagcagctctgggcctggtggatcctgtcaagggaatatca
ctgcggtttcctcgctttttaagaatccgagatgataagaaacctgaacaagccacggac
agttcacaggttgcggaaatgtacagaagccaagaaactgtaaagaataacgcaaatcct
ccaccaaccatagacgcctccgatgacttctattga

DBGET integrated database retrieval system