KEGG   Pocillopora damicornis (lace coral): 113671878
Entry
113671878         CDS       T05773                                 

Definition
(RefSeq) fibroblast growth factor 1-like
  KO
K18496  fibroblast growth factor 1
Organism
pdam  Pocillopora damicornis (lace coral)
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pdam04052]
    113671878
   00536 Glycosaminoglycan binding proteins [BR:pdam00536]
    113671878
Cytokines and growth factors [BR:pdam04052]
 Growth factors
  Growth factors (RTK binding)
   113671878
Glycosaminoglycan binding proteins [BR:pdam00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113671878
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 113671878
NCBI-ProteinID: XP_027043936
LinkDB
Position
Unknown
AA seq 226 aa
MELSTMNYMYLLYVHLLLSYFTEIHSSAKPYKETKPQKKELKPLKGPHSTSRNDEDNTQN
RFLRTFLLNRQKRPRSSTENSFRRVRKITKRPTTTTNCKIFCRSGYHLQILPSGVVRGTV
DQDSEYVLFEMQSFGPSLVRLMSPATGRYLTMKRDGTLRGLRSQTTRDSLFKETHEENAF
HSYASYRYYRKQPHDMLVGIKRNGQIKRATKTFHGQTATQFLVIKF
NT seq 681 nt   +upstreamnt  +downstreamnt
atggagctgtcaactatgaactacatgtatctgctctacgttcatcttctactctcatat
tttacggagatacactcgtcagccaaaccatataaagaaacaaaaccgcaaaagaaagag
ctgaaaccactcaaaggacctcactcaacttcaaggaacgatgaagacaacacccaaaac
cggttcctaagaacgttcctcctcaataggcagaaacgtccacgatcttccacagaaaac
tcttttcgacgcgtccgcaagataacgaaaagaccaacaacgaccacaaactgtaaaata
ttctgccgcagtggttatcaccttcaaattctccccagtggggtagtgaggggtacggtt
gaccaggacagcgagtacgtgttgtttgagatgcagtcattcgggcccagtctcgttagg
ctgatgagtccagcgacgggcaggtatctaactatgaaaagagatgggacacttcgtggg
ttgagaagccaaaccacccgagactcgctcttcaaagagactcacgaagagaacgcgttt
cactcttatgcgtcttacagatattacagaaaacagccacacgacatgttggttggaatc
aagaggaacgggcaaataaagcgcgccacgaagactttccatggacaaactgctacacaa
tttcttgtcatcaaattttga

DBGET integrated database retrieval system