KEGG   Pocillopora damicornis (lace coral): 113672022
Entry
113672022         CDS       T05773                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase XIAP-like
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04120  Ubiquitin mediated proteolysis
pdam04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    113672022
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113672022
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pdam01002]
    113672022
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pdam04121]
    113672022
Peptidases and inhibitors [BR:pdam01002]
 Peptidase inhibitors
  Family I32: IAP family
   113672022
Ubiquitin system [BR:pdam04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    113672022
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_5
Other DBs
NCBI-GeneID: 113672022
NCBI-ProteinID: XP_027044092
LinkDB
Position
Unknown
AA seq 861 aa
MQKRQETQDLPSMEAESMNSQMSYSSAEFSDRGNSFNGFEENSQHINNANISEMLNQQPN
LVSYKKRLETFTRWPSSSPVKPTDLAAAGFYSVNLDDRVACFRCNLHLRQWNVGDDPWME
HKRLRPSCPFIKEGENLNGHVVTCNPVEASTGVREPVHPPFPTVTHARYGDHVYLTERDP
PVNRERLIYPERPQYVTHGSMFDTQELHYPVETRTGVPQDYYDLRRRPQEFLGKDPMPVD
FQRCPEHEQTATERNQHVVVRQGANQIHIVGPAVYQLNPEDELNIQKGEHGFHPQIRTER
DLRQVYPGPQRTGRVPPSTETNFTGSHPFPRDPYRYISEEQRSGTNQFKQSVISYPPSYS
GTFPNQTGYQRSESVTNESPVKFHKGNPSEKNPSKSENDIVEARPTQPPCNWQQFPPGRN
VPGSRRQSQGYYPAFPVKDPSLQTEELPLIRQEYARHVSSPSDLSNEHHRLTTYVDWPHN
HHIRPWDLSAAGFYYLGTGDSVKCFKCGIMLHNWEPSDTPWGEHQKWSTQCPLVLEHLRE
RPQAPTPSTPAEHAVQRVPSVQNERPSWRPGQSQSGQDLHTPIRSGNTSPLQGTWNTSEK
YPACTMPNSANGWNPSTEQRYSQWHNQTVTTSSHESYMTNESQTRFTGGSSSRAPNEVTQ
EPRSCSPRGSTAMELDMEKLGEMGFTQRDIQEAVAAKIGSTGSNFSTFTELVSALLERQL
AGAPTFGSCAQLTPQEGEERPPRPHLNIPERQPSPREDEDLRKKNCLSAVTSPTTPVPRR
DNLRRTLSAPASGSSDTEESLEEKLERMQEERTCKICMDAEVGMVFLPCGHLSCCPDCAR
GMDFCPMCRGPIIEKIRTYLS
NT seq 2586 nt   +upstreamnt  +downstreamnt
atgcagaagcgacaagagactcaagacttgccgtcaatggaagcggaaagcatgaattca
caaatgtcttacagttctgctgaatttagtgatcgaggcaacagctttaatgggttcgaa
gagaattcgcagcacataaacaatgccaacatatctgaaatgcttaatcaacaaccgaat
ttggtcagctataaaaaaagattagaaacctttacacgatggccatccagcagccctgta
aaacccaccgatttggccgcagccgggttctatagtgtcaatttagacgatcgagttgcg
tgtttcaggtgtaatttgcatttacggcagtggaacgtaggagatgatccgtggatggaa
cacaaacgacttcggccttcctgcccttttattaaagaaggtgaaaatttgaacggtcac
gtagtaacttgtaaccctgtagaagcttcaacaggtgttcgagaaccagtccatccaccg
tttccaacagtaacgcacgcaagatatggagatcatgtgtatcttaccgaaagagatccc
ccagtgaatcgtgagaggttgatatatcccgaaaggccacagtatgttacacacgggagt
atgtttgatacccaggagctgcattaccctgtggaaactcgaaccggtgtcccgcaggat
tattatgatcttagaagaagaccacaagagtttctcggaaaagatcccatgcctgttgat
tttcaacgctgtccagagcacgagcaaaccgctacagaaagaaatcagcatgttgtggtg
agacagggagccaatcagattcacattgtgggaccggctgtctaccagcttaacccagag
gacgaacttaacatacaaaaaggagagcatggcttccacccgcagattaggactgagaga
gatttgagacaagtatacccagggcctcaacggacaggccgagtgccaccatcgacggag
acgaacttcacaggttcacatccttttcccagagacccttaccggtacatttcggaagag
caaagatcaggcacgaaccagtttaaacagtccgtcatatcttatccaccaagctattct
ggaacgtttccaaatcaaactgggtatcagcgttcagaaagtgtaacgaacgaaagtccg
gtgaagttccataaaggaaacccaagtgaaaagaacccgagcaaatctgaaaacgatatt
gtcgaggcaagacccactcaaccaccctgtaactggcagcagtttccgccgggtcgaaat
gttcctggctcaagaaggcaatcccaagggtattatccagcttttccagtcaaagacccc
agcctccagactgaagagctgcctttgataagacaggaatacgctcgccatgtgtcgtca
ccatctgacttgtctaatgagcatcatcgtctgacgacatatgtggattggccgcataat
caccatattcgtccgtgggatctttcggctgccgggttctattacttgggtactggcgat
tccgtcaagtgcttcaaatgcggcatcatgctgcacaactgggaacccagtgacactcct
tggggggagcatcagaagtggtctacgcagtgtcctttagtactagagcacttaagagag
cgtcctcaggcacctactccaagcactccagccgaacatgctgtacaacgtgttccttcg
gtgcaaaatgaacgtccgagttggcgccctggacagagtcagagcggacaagatctacat
acgccgattagaagtggtaacacatcgccccttcagggaacttggaatacctctgagaag
tacccagcatgcaccatgcctaactcagccaatgggtggaatccttcaacggaacagcgt
tattcacagtggcataatcaaacagtcactacgtcatcgcatgaaagttacatgaccaat
gagagtcagactcgatttactggaggatcaagttcaagagcacccaacgaagtaacgcag
gaaccacggtcttgttctcccaggggaagcactgccatggaacttgacatggagaaacta
ggggagatggggttcactcagcgtgacatacaagaggcagttgctgctaaaattggatcc
acaggatccaatttcagcacgtttactgagctcgtttccgctctcctagagaggcagctg
gcaggagcacccacctttggatcctgtgcgcagctaacgccacaagaaggtgaagagcgg
cctcctcgtccccatctcaacattcccgagagacaacccagtcctcgagaggatgaagat
ctccgaaagaagaactgtttgagtgctgtgacgtctcccactactccagttcctcgtagg
gacaatctgcgaagaacccttagtgcgcctgcatcaggatcatcggatactgaagagtcg
cttgaggagaagctggagcgaatgcaagaagaacgcacatgcaagatctgcatggacgct
gaagtgggaatggtgtttttgccctgcggccatttgagctgctgtcctgattgtgcacgt
ggaatggacttctgtcctatgtgccgcggaccgataatagagaagattcgtacgtatcta
tcttaa

KEGG   Pocillopora damicornis (lace coral): 113680087
Entry
113680087         CDS       T05773                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 5.2-A-like
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113680087
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pdam01002]
    113680087
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pdam03036]
    113680087
Peptidases and inhibitors [BR:pdam01002]
 Peptidase inhibitors
  Family I32: IAP family
   113680087
Chromosome and associated proteins [BR:pdam03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     113680087
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    113680087
SSDB
Motif
Pfam: BIR zf-C3HC
Other DBs
NCBI-GeneID: 113680087
NCBI-ProteinID: XP_027052887
LinkDB
Position
Unknown
AA seq 138 aa
MAELTYDFNMNRFKNRLETFKDWPFTEETGSCCTAMKMAEAGFFHSANDSVDVARCFVCL
KELEGWEPEDNPFEEHRKHSPKCEFLLLNKKEEDWTVQEFLELETKRQMNVMQKIIELKT
KEFLELAEHVQSEMEKLV
NT seq 417 nt   +upstreamnt  +downstreamnt
atggctgagttaacttatgattttaacatgaatagattcaaaaatcgcctggagaccttc
aaagactggccctttacggaagaaacgggatcttgttgtactgcgatgaagatggctgaa
gcaggcttcttccacagcgcgaatgattctgttgatgttgcacgttgctttgtttgtctc
aaagaactcgaaggatgggagcctgaggacaatccatttgaggaacacagaaagcattct
ccgaaatgtgaatttttgttgttgaacaaaaaagaagaagactggacagtgcaagaattt
ttagaattggaaacaaaaaggcaaatgaacgtaatgcaaaagatcattgaactcaagaca
aaagaattcttggaactggctgaacatgtccaaagtgaaatggaaaagcttgtttaa

DBGET integrated database retrieval system