KEGG   Pocillopora damicornis (lace coral): 113672485Help
Entry
113672485         CDS       T05773                                 

Definition
(RefSeq) tuberin-like
  KO
K07207  tuberous sclerosis 2
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04140  Autophagy - animal
pdam04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    113672485
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113672485
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pdam01009]
    113672485
Protein phosphatases and associated proteins [BR:pdam01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     113672485
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tuberin DUF3384
Motif
Other DBs
NCBI-GeneID: 113672485
NCBI-ProteinID: XP_027044574
LinkDB All DBs
Position
Unknown
AA seq 1248 aa AA seqDB search
MLDTFRVQGLIDTDFMVFGLQHAIEAAWDAVKDLLNPSNPTEARHLTLQFLTVMISGQFN
RLGILRAHFFSVVVNHKIPEDITPRLELLQALSDNGKDISYFEERTGPFLLSWMPEVMQK
GRMIFFMPLLINVIHYNSSFLDEDIISGIVRQTCHLSRTTKEEGEVELCLCLLDAVVRYS
CLPSNTLFEFIATACRAVNIEKFCQRSWKIMRNLLGTHLGHSGVYTMCNVLEDSDNRSDA
MLLRGSVFFIGMCLWGSQRVPNLKYSSSTVLPSMLQALSCHLSLVALEVTLSLQRLVKKY
GQELHVVAWDAVLDIIEALQQEIEEISPPDNVLIENLHILLFNVEDLYESGKFNGPEERF
FALLEKSAGMLPDRSLQILISYKAQSVHPAHVGWLVNLHDLMEKYFRYEIRTSVRVKALT
VLSSVLTSYGHWYEEELLEHAVLPYLIHIPEDQDVTVRNVAVQILLDLCQMSDSQKCQDF
LDIIEKVISRHVELQGKSPPLEQQEQMLQEEKELKDVKTAVSGLVEVFKLKLFRLPHGHA
VRTFELLVSHVKAHYNHCYSTYIASVIRNLAFECFLSLRCDSSLRLGLSDASEEEEEERS
SRFSPYFTCLQSDSDTKTSSSSHLALISYSDVFQAILNCLQYEWDWTVLEHVLSGLPEVL
QNKSLILSANPALNTMTSVLCNMVSEPSFILDLRRVPPGVGRVGLQALIFPVLSVLATYH
SNLDRGRQFELVRTLELGLVTKCAVLCVSSLTLCTMEMQAVMKSLLPALLVRLTQISATV
AMAAPMLEFLSGLVHLPHLYASFQDSQYKSVFAISLPYTDPFKYSQYTITLAYHVIAAWF
IRSRVAYRKAFVGFVSKGLKSSAIIPDRYEPKPDSPSLATTKSRTGNSTNQPSPQIHNRS
SSPVVHKETETACELHAEMSEVCMDMMARYTFAPCMSQPNRTKAVELMLANGHSRTWMIG
NTIVTITTSGTYIGQDGNCDNCLALRQRTVNMSPKESAKTERNVKQKITAVDVTTEDSHI
QSPDEKGHGTFTSHGTGTQTPAGADESSKPEVKSEFHSGALSDRRLSGQFVAINPQNCRC
VCQGWAEIFIRRPSGNISWIMRIQNRATSWLESDVSTALIDDPQIDEFSSPPCEMRGEVL
STSTESGSVIIDVVRQSNPPEGVGAAFHDTARGESLARSGWQHGSTDGDKDADVPQLNSV
LIYSQSASTATPPSTPAGSVDSELFEGRERLLSRSPSKGPHVFTVRRV
NT seq 3747 nt NT seq  +upstreamnt  +downstreamnt
atgctagacacttttagggtccaagggttaattgatacagactttatggtgtttggtttg
cagcatgctattgaagcagcttgggatgcggtcaaggaccttcttaatccaagcaaccct
acggaggcaagacatctcactctccagtttctgacagtgatgatatctggacagttcaac
agacttggtattttaagggctcatttcttctctgttgtggttaatcacaagattcctgag
gacatcacacccaggttggaattactgcaagcattgagtgataatgggaaagacatttca
tactttgaggaaaggactggtccttttctgttatcttggatgccagaagtgatgcaaaaa
ggcagaatgatttttttcatgcctcttcttatcaatgtaattcactacaactcaagtttc
cttgatgaggatatcatctctggcattgtcaggcaaacctgtcatctttcaagaacaact
aaagaggaaggagaagttgagctgtgcctgtgtttgctggatgctgtggtccgttacagt
tgtctgccgtccaatacattgtttgagttcatagccacagcctgccgggctgttaacatc
gaaaagttttgtcagcgcagctggaagataatgagaaatttgcttggaactcatctgggt
cacagtggagtgtacaccatgtgtaatgttttggaagacagtgacaacagaagcgacgcc
atgctgttaagaggctctgtgttcttcattggaatgtgtctgtgggggtcacagcgagtg
ccaaacctcaagtactccagttccactgttttaccttctatgctacaggctttgtcgtgc
catctcagcttggtggccctggaagtgaccctctccctacagagacttgtgaagaagtat
ggtcaagaacttcatgttgtggcctgggatgcggtgttagatatcattgaagctctgcaa
caagagatcgaggaaattagcccgcccgataatgtcctgattgaaaatcttcacatcctg
ttgttcaatgtagaagatctctacgagagtggaaagtttaatgggcctgaagaaaggttc
tttgctttgctggagaagagtgctggaatgttacctgatcgttctcttcaaatcttgatt
tcatacaaagcccagtcagtgcatcctgctcacgttggatggctcgtgaatcttcacgat
cttatggaaaaatacttcaggtatgaaatccgcacaagtgtaagagtgaaagcgctgact
gtcctttcatcggtgcttacatcatatggccactggtatgaggaagagttgttggagcat
gcagtgttaccataccttattcacattcctgaagaccaagatgtaacagtacgcaatgta
gctgtgcagatattgctggacttgtgtcagatgtcagactctcagaagtgtcaagacttc
ttggacataatcgagaaggtcatcagtaggcacgtggagctgcaaggaaagagtcctcca
ctagaacagcaggaacagatgctgcaagaggaaaaagaactaaaggatgtgaagacagcg
gtcagcggactggtcgaagtgtttaagctcaagttgtttcgtttaccgcatggtcacgct
gtacggacatttgaattgctggtctctcacgtgaaggcgcactataaccattgttacagt
acttacattgcaagtgtcatcaggaacttggcctttgagtgctttctgagtttacgctgt
gactccagtttacggctgggtttgtctgatgccagtgaagaagaagaagaagaaaggagt
tctaggttcagcccctactttacttgtttacagagtgactctgacacaaaaacgtcgtca
tcgtcacatcttgctttgatatcttactctgacgtgtttcaagccattttgaactgcttg
cagtatgagtgggactggacagtactggagcatgttttgagtggactaccggaggtccta
caaaataagagccttattctatcagctaatcccgcgttaaataccatgacgtcagtactg
tgcaatatggtttcggaaccttctttcatcctggatcttcgtcgtgttcctcccggtgtc
gggagagtaggacttcaggctttgatttttccagttttatcggttcttgccacataccac
tccaacctggacaggggacggcagttcgagttggtgaggactttggagctgggtttagtg
accaagtgtgctgtcttatgtgtctcttcactcaccctgtgcaccatggaaatgcaagca
gttatgaaaagtcttcttccagctcttttagtgcggttgactcagatctccgcaactgtt
gccatggcagcacccatgctggagttcctttcaggtcttgttcatcttccacatctgtac
gccagttttcaagacagtcagtacaagagcgtattcgccattagcctcccttacactgat
cctttcaaatattctcagtacaccataacgcttgcttatcacgtgattgctgcgtggttt
attcgatcacgtgtggcgtatcgcaaagcatttgtgggattcgtgagtaagggtctcaaa
tcaagtgctataattccggaccgttatgaacccaaaccagacagcccctctctagcaacg
accaaatctcgcactggaaactctacaaatcagccctcgccccagattcataatcggtca
agttcgcccgtagttcacaaggagactgaaacggcgtgtgagctacatgctgaaatgagt
gaagtttgtatggacatgatggccagatacacgtttgctccgtgtatgtcacagccaaac
aggaccaaagcggtggagttgatgctagccaatggtcattctcgtacttggatgatcggt
aatacaatagtaaccataaccacctcaggtacttatatcggccaggatggtaattgcgac
aactgcctggctctgagacaaagaacagtaaatatgtcaccaaaggaaagcgcaaaaaca
gagaggaatgtcaaacagaagatcaccgcggtagatgttacgacagaagattctcatatc
cagtctcccgacgaaaaaggtcatggcacgtttacgagtcatggaactgggactcagact
cccgcgggcgctgatgaatcttcgaagcctgaggtgaagtcagagtttcatagcggcgca
ctatcagaccggcggctcagtggacagtttgttgctatcaatccacaaaactgtcgatgt
gtttgccaaggctgggctgaaatctttatccgtcggcccagcggaaacatctcttggatc
atgcgcattcagaatagggctacgtcatggttggagagtgacgtcagtactgcccttata
gatgaccctcagatcgacgaattttcttccccaccctgtgaaatgcgaggagaggtcctg
agtaccagtactgaaagtggctctgttattattgacgtggtgaggcaaagtaatcctcca
gagggggtaggagctgcttttcatgatacagcccgtggggagtcactcgctcgttccggc
tggcaacatggcagcacagatggcgacaaagatgctgatgtacctcagctgaattcagtg
ctcatttattcacaaagcgctagcacggccactccgccaagcacaccagcggggtctgta
gattctgagctcttcgaaggaagagaaaggctcttaagtaggagccccagtaaaggacct
catgtttttacggtacgccgggtttga

DBGET integrated database retrieval system