KEGG   Pocillopora damicornis (lace coral): 113673481
Entry
113673481         CDS       T05773                                 

Definition
(RefSeq) bcl-2 homologous antagonist/killer-like
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04141  Protein processing in endoplasmic reticulum
pdam04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113673481
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113673481
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pdam03029]
    113673481
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pdam02000]
    113673481
Mitochondrial biogenesis [BR:pdam03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    113673481
Transporters [BR:pdam02000]
 Other transporters
  Pores ion channels [TC:1]
   113673481
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 113673481
NCBI-ProteinID: XP_027045703
LinkDB
Position
Unknown
AA seq 222 aa
MASGGGDSSENNQDIPPNEDERTVFQDTEGIFRHFMFQRYQDETQRGEEHGEMDSPSASA
RPDALEELRSCNDIHPFSQHVPVIGRRLGEIGDEIDAKYKDQFKDMIDSLSLTPATAYET
FAAVARRLFRTGINWGRVVALLCFGYEIAVTVIRRGFSGSFLRRIIRFVVDFIFKERIAR
WIAQHGGWRAVMDFRLSEPSWYTVGIVLLLGTMAVFLATRKT
NT seq 669 nt   +upstreamnt  +downstreamnt
atggcttcaggtggaggagactctagtgaaaataatcaggatattccgcctaacgaggac
gaaagaactgtattccaagatactgaagggattttcagacattttatgttccaacgctat
caggatgagacacaaagaggagaagaacatggtgaaatggacagtccttcggccagcgca
cgtccagacgcgctggaagaattgcgttcttgcaatgacatccatccattttcacagcat
gtaccagttatcggtagacgcctcggagagataggcgatgaaatagatgctaaatacaaa
gatcaattcaaggatatgatagactcattaagcctaacgccagcaacggcctacgagaca
tttgccgcagtcgctcggaggttgtttcgtacaggtataaactggggaagagtggttgct
cttctttgctttggctacgaaattgccgtgactgtcatacgcagaggttttagtggtagt
tttctacgtagaatcatacgatttgtggtggattttatcttcaaagagcggatcgctcgc
tggattgctcagcatggaggatggagagctgtgatggattttcgcctgtcagaacccagc
tggtacacagttggtattgtgcttttgttaggaaccatggctgttttcttggccactcgg
aaaacatga

DBGET integrated database retrieval system