KEGG   Pocillopora damicornis (lace coral): 113674379Help
Entry
113674379         CDS       T05773                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam00020  Citrate cycle (TCA cycle)
pdam00190  Oxidative phosphorylation
pdam01100  Metabolic pathways
pdam01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    113674379
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    113674379
Enzymes [BR:pdam01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     113674379
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 113674379
NCBI-ProteinID: XP_027046663
LinkDB All DBs
Position
Unknown
AA seq 623 aa AA seqDB search
MALVENVYQLSREYPVVDHSYDALVVGAGGAGLRAAFGLAHEGFKTACITKLFPTRSHTV
AAQGGINAALGNMEPDDWRWHMYDTVKGSDWLGDQDAIHYMTEEAPKSVIELENYGMPFS
RTEKGQIYQRAFGGQSYNFGKGGQAHRCCAVADRTGHSLLHTLYGQSLRYETEYFVEYFA
LDLLMDQGKCVGVIALCLEDGSLHRFKAKNTVIATGGYGRAYFSCTSAHTCTGDGTAMVA
RAGLPNQDMEFVQFHPTGIYGAGCLITEGSRGEGGYLINSEGERFMERYAPTAKDLASRD
VVSRSMTIEIREGRGVGPDKDHVYLQLSHLPAETLKTRLPGISETAMIFAGVDVTRDPIP
VIPTVHYNMGGIPTNYMGQVLTKKEGKDEVVPGLWAAGESACASVHGANRLGANSLLDLV
VFGRACANFISKFNKPDETLPELPLNAGEESVANLDKIRYANGSTPTADLRMNMQKTMQE
HAAVFRTGTVLADGCRKIDDIYNQTEDLKLFDRGMVWNTDLVETLELQNLLINCKQTLYG
AEARKESRGAHAREDFKERIDEYDYSKPLEGQTKRPFDSHWRKHTLAWTEHNTGETTLDY
RGVIDETLDQKDCASVPPAVRSY
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atggcactagtcgaaaatgtctatcagttatcacgggaatatcctgtggtagaccacagt
tatgacgctttagttgttggtgctggaggtgctggtttacgtgcggcctttggtcttgca
catgaaggatttaaaactgcttgtatcaccaagcttttcccaacaagatcacatactgtt
gcagcacagggaggaatcaatgctgctcttggaaacatggaacctgatgattggcgttgg
catatgtatgacacagtgaaagggagtgactggcttggggatcaggatgcaattcattac
atgacagaggaagccccaaagtcagtgattgagcttgaaaattatggaatgcccttcagt
cgaacagaaaagggccagatttatcagcgcgcatttggtggtcagagctataattttggt
aagggaggtcaggcacacagatgttgtgctgttgctgacagaacaggtcactccttgctt
cacactttgtatggccagtccttgagatatgaaacagagtattttgtggagtattttgca
ctggatctcctcatggaccaaggaaagtgtgtgggagttattgccttgtgcctcgaggat
gggtcacttcacagatttaaggcaaagaacacagtgatagcaactggtgggtatggccgt
gcctatttctcctgtacttcagcacacacctgtactggagatggaacagccatggtggca
agagcaggacttcctaaccaagacatggagtttgtccagtttcatccaacaggaatttat
ggtgctggttgtctgattactgagggaagcagaggagaaggaggttatcttatcaacagt
gagggagagagatttatggagagatatgcacctacagctaaagacttggcatcaagagat
gttgtgtccagatcaatgacgattgagatcagagaaggaagaggggtggggccggacaaa
gatcatgtgtaccttcaactgtcccatcttccagctgagacactcaagacacggttgcct
ggaatatcagagacagccatgatctttgctggagtcgatgtgaccagggaccccatccct
gttattcccacagtgcactacaacatgggaggtatccccacaaactacatgggtcaggtt
ttgacaaagaaggagggcaaagatgaagtcgtgccaggcctctgggcggctggagagtct
gcatgtgcctcagtccatggtgcaaacagactgggtgctaactccttgttggatctggtt
gtgtttggacgagcatgtgcaaatttcatttctaagtttaacaagccagatgagacactt
cccgagctccctttgaatgctggagaggagtctgttgctaacttggacaaaattcgatat
gctaatggcagtacacctactgcagatttgagaatgaacatgcaaaagactatgcaggaa
catgcggctgtatttagaactggtacagtcttggctgatggctgccgaaaaattgatgat
atctacaaccagacagaagacctcaagttgtttgatcgtggcatggtgtggaacacagat
ttggttgaaacgcttgaactacagaatcttctcatcaactgcaagcagactctttatgga
gcagaggctcgtaaggaaagtcgtggtgcgcatgctcgagaggatttcaaggaacgtatc
gatgagtatgactactccaagccgctggaaggtcaaacaaagcgtccgtttgatagccac
tggagaaaacacaccttggcctggactgaacataatacaggagagacaaccctggattat
cgaggagttatcgatgaaactctggatcagaaagactgtgcctctgtccccccggcagtt
cgctcttactag

DBGET integrated database retrieval system