KEGG   Pocillopora damicornis (lace coral): 113675374
Entry
113675374         CDS       T05773                                 

Definition
(RefSeq) uncharacterized protein LOC113675374
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    113675374
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 113675374
NCBI-ProteinID: XP_027047747
LinkDB
Position
Unknown
AA seq 180 aa
MTSVSRDAGRGRVKDVKRNLFGTVDHKQIRDDLARELKYMSEEKKCQWNFDFENCQPLSG
RFKWQRVGKRLQTRKSPTEGISTCDTESSENFCRQNIVDPTHSAARYNLRTRGREGESIP
RSGFVPIDPSRKRLREFGDAPAGNRNKKVAGNCVKQRNSRERRAKTSVIKRPYEAKRARR
NT seq 543 nt   +upstreamnt  +downstreamnt
atgactagcgtcagtcgtgacgcgggtagaggacgcgtcaaagacgtcaagagaaacctc
tttggaacagttgatcataagcaaattcgagacgatttagccagagagttaaagtacatg
tcagaagaaaagaaatgccagtggaattttgattttgagaattgtcaaccgctttcaggt
agattcaagtggcagcgagttggaaagagactacaaacccgtaaatcgccaaccgaaggg
atttctacgtgtgacacggaatcttccgaaaatttctgtcgccaaaacattgtcgatcct
acccactctgccgcaaggtataatctaagaactagaggcagagaaggggaaagcattcca
aggagtggtttcgtaccgatcgacccttcgcggaaacgtttacgagagtttggcgatgcg
ccggctggaaatagaaacaaaaaagtcgcaggtaattgcgtgaaacagagaaattctaga
gaaagaagagccaaaacttcggtaataaagcgaccttacgaggccaagagagctcgacgt
tga

DBGET integrated database retrieval system