KEGG   Pocillopora damicornis (lace coral): 113675681
Entry
113675681         CDS       T05773                                 

Definition
(RefSeq) mucosa-associated lymphoid tissue lymphoma translocation protein 1 homolog
  KO
K07369  mucosa-associated lymphoid tissue lymphoma translocation protein 1 [EC:3.4.22.-]
Organism
pdam  Pocillopora damicornis (lace coral)
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pdam01002]
    113675681
Enzymes [BR:pdam01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     113675681
Peptidases and inhibitors [BR:pdam01002]
 Cysteine peptidases
  Family C14: caspase family
   113675681
SSDB
Motif
Pfam: Ig_2 Peptidase_C14 Ig_3 I-set ig Ig_5 Ig_4 V-set MALT1_Ig CHAT Izumo-Ig
Other DBs
NCBI-GeneID: 113675681
NCBI-ProteinID: XP_027048078
LinkDB
Position
Unknown
AA seq 689 aa
MDSRCITDLPDDIKKQIAAILDASEQPNWKSLVHEVIRHKIPSYKDPCQVYAIGMATLSP
GGSPTLKLLQDLGQSQITVKVFKSWISSMSEGSPGLQKVISLLTFSPTITQDVKKEIRGI
PGQNVYIHCEALGHKPLQFQWFKKRELLQGETGNKLELKSVSESDGGYYTCRIANCHGCI
FTSWAKLIIDEDSGAHSSSPFDLPIITSQSDPDVHILLGSRLSLYCDGVGRPAPSYQWFH
DDSPIPEATHRWLIKNNVSAEDQGFYHCKVYNTAGEMHSHNFKVTIESLQVNIDNLTTAR
DSYTRGPRDRVANKVALLIGNKDYCDQQLGKLFHPINDVCDFTGRLINMGFKVVSLVNLT
LEEMRKALAEFCMLLVEDTYAVFYFAGHGFERGGLSYLMPVDATPLYHWQENMASAEVLK
AMQETKAKLKLVLLDCCRTEPDHVAQNSPLLSGDLQDIKEPNVVVAFGCCPRSSVFECEQ
EKNGFFAKHLLKAISDEHRNKSVEEVLLHVSRGIHEENLVDYLTNQKQIVNRITTSVKPM
SLWTPVDNISLNPSAEEATAKWKSAHEIPNDPVTVYQDDKVRVELIFNAEVSNVLIVNAR
ALGEDSLDLNVTFEMSNVVSGCCVARGDMLGKKCRPSEATLKVKDLQRLTGPLVFKLTCI
YTVNGERQLKSISYTMEEKPLYAKLVTRW
NT seq 2070 nt   +upstreamnt  +downstreamnt
atggattcaaggtgtatcacagacttgcctgatgatataaaaaagcagatagcagcaata
ctggacgcatctgaacagcccaactggaaatcacttgtccatgaggttataagacacaag
ataccatcatataaggatccatgtcaagtttatgcaattggaatggcaactttgtcacca
ggaggaagcccaactcttaaactattgcaagacttgggacagtcacaaataactgtgaaa
gtcttcaaaagctggatcagttccatgagtgaagggtcaccaggcttacagaaagtaatt
agtttactaacattttctccaactataactcaagatgttaaaaaagaaatacgaggaatt
ccaggacagaatgtttacatacactgtgaagcattaggacacaaaccacttcaatttcaa
tggtttaaaaaaagagaacttcttcaaggggaaacaggaaataagctagagctcaagagt
gtcagtgaaagtgatggaggatattatacatgccgcatcgcaaattgtcatggttgtatt
ttcaccagctgggccaaattgataattgatgaagacagtggtgctcacagctcttcaccc
tttgatttgccaatcattacttctcaatcagaccctgatgttcacatacttctgggttca
cggctaagcttatactgtgatggcgttggcagaccagctccaagctatcagtggtttcat
gatgattctcccatcccggaagcaacacacagatggttgataaaaaacaatgtttctgca
gaagatcagggattttatcattgtaaagtgtacaacactgctggggaaatgcattcacac
aattttaaagtgactattgaaagtttgcaagttaatattgacaatcttaccacagccaga
gattcctatacacgtggtccgcgtgatcgagtcgcaaataaagttgccctgttaattgga
aataaagattactgcgatcaacaacttggaaagctttttcatccaatcaacgatgtttgt
gactttacaggcagacttatcaatatgggttttaaagtggtttcattagtaaacctaaca
ctggaggagatgagaaaagctcttgcagagttctgcatgcttcttgtcgaagatacctat
gctgtgttctactttgctggccatggttttgaacgcggtggattaagctatctaatgcca
gtcgatgccacgcctctatatcattggcaagagaacatggcttcagctgaagtacttaag
gccatgcaagaaactaaggcaaagttaaagcttgtgttgctagactgctgcagaacagaa
ccggatcacgtggcgcagaacagtccgttacttagtggggatttacaagatataaaagaa
ccaaatgtggtagtagcatttggctgttgcccgcgttcaagtgtgtttgaatgtgagcag
gagaagaatggctttttcgcgaagcacctcctgaaagctatttcagatgaacacaggaat
aaatccgtcgaagaagttttgttacatgttagtcgtggtatacacgaagagaacctcgtg
gactatcttacaaatcaaaaacagattgtgaacaggataaccacttcagtcaaacctatg
agtctctggacccctgtggacaacatctcattgaatccgtccgctgaagaagcaactgca
aagtggaaatcagctcatgaaattccaaatgatccagttaccgtctatcaagatgataaa
gtgagggttgagttgatttttaacgcagaagtgtcaaatgtcttgatagtgaatgcacga
gcgctgggagaggacagcttggacttaaatgtcacgtttgagatgtcgaatgttgtgagt
ggatgctgtgtcgcgcgaggtgacatgttgggaaaaaaatgccggccatcagaagcgacg
ttaaaagtcaaagaccttcaacggcttacgggaccgttagtctttaaactgacttgtata
tatacagtcaacggagaaagacagctaaagtcgattagttacacaatggaagaaaaacct
ctctatgctaagctggtaacacgttggtga

DBGET integrated database retrieval system